BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30193 (307 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) 27 3.0 >SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) Length = 1348 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 189 KLIFARLKTLRTGMQLYDPI*TELSSQDRWLGSYC 85 K++ +K+L QL D SS WLGS C Sbjct: 718 KILLEAVKSLPVHPQLVDSNAQSFSSASEWLGSLC 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,234,288 Number of Sequences: 59808 Number of extensions: 115773 Number of successful extensions: 190 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 377252670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -