BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30191 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_28276| Best HMM Match : Cerato-platanin (HMM E-Value=6.7) 28 6.7 SB_933| Best HMM Match : ExoD (HMM E-Value=6) 28 8.9 >SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1079 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 501 CSCYRCSRWHFDFPGACGTPACADSDVVNWERFGIRPGYEW 379 C C R + FD GAC T C + + + E F + PGY W Sbjct: 346 CFC-RKNHHRFDRFGACFT--CPNGMICSNETFTLAPGYYW 383 >SB_28276| Best HMM Match : Cerato-platanin (HMM E-Value=6.7) Length = 225 Score = 28.3 bits (60), Expect = 6.7 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 274 VEIESPGILNGGEYRGFWVRWDSGIISAGREGEAIPFISWSDPEPFPV-YYV 426 + I + GI + + FWV + S + G I W+DP+P V YY+ Sbjct: 1 LNIATSGITSAEKRMVFWVDFRSANLVLGSGATVIA--QWTDPDPLEVGYYI 50 >SB_933| Best HMM Match : ExoD (HMM E-Value=6) Length = 555 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 266 PIRLKLKAPEFLTEGNIVVFGFVG-IAALSPLDARVKLFHSYPG 394 P ++ K P L +G I+ GF+G ++AL ++LF G Sbjct: 100 PYVIRPKGPRLLRQGTIMKAGFIGLVSALGVYACNLELFRRCAG 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,290,379 Number of Sequences: 59808 Number of extensions: 509559 Number of successful extensions: 1489 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1488 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -