BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30186 (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 2.2 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 21 6.8 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 21 6.8 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 21 6.8 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 9.0 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 566 YKF*GSQYSYNGCS 525 Y F G+ Y Y GCS Sbjct: 17 YPFQGTTYKYTGCS 30 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 119 VANYSESHIPLLDVLPTKKNIYLQFYSFHSV 27 +A+Y + L D+L N Y + YS +S+ Sbjct: 224 IAHYRVLWLSLSDLLQKMGNAYARTYSTYSL 254 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 119 VANYSESHIPLLDVLPTKKNIYLQFYSFHSV 27 +A+Y + L D+L N Y + YS +S+ Sbjct: 224 IAHYRVLWLSLSDLLQKMGNAYARTYSTYSL 254 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 119 VANYSESHIPLLDVLPTKKNIYLQFYSFHSV 27 +A+Y + L D+L N Y + YS +S+ Sbjct: 224 IAHYRVLWLSLSDLLQKMGNAYARTYSTYSL 254 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 560 TYISRWVAHLRWAPV 604 T S+W+AH +AP+ Sbjct: 251 TIDSQWLAHWAFAPI 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,681 Number of Sequences: 336 Number of extensions: 3296 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -