BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30186 (664 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82284-2|CAB05290.1| 402|Caenorhabditis elegans Hypothetical pr... 30 1.7 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 27 9.0 >Z82284-2|CAB05290.1| 402|Caenorhabditis elegans Hypothetical protein T27E7.3 protein. Length = 402 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 285 LKRNSFSFLNIKATAGEHSKIQRFTNHLF 371 LK+N F+ K T G+ ++I +F +H+F Sbjct: 40 LKKNCACFIGFKKTTGKSAQIVQFADHIF 68 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 8/68 (11%) Frame = +3 Query: 234 FPNFKL*WRSCKIAKMALKRN-SFSFLNIKATAG-------EHSKIQRFTNHLFAKLVVK 389 +P + C+I ++L FSF + G + SK T H+FA + +K Sbjct: 6970 YPTVSMFGAKCEIEHLSLNNAFDFSFTIDETPTGSLITVDFDKSKYLDTTVHMFANIFLK 7029 Query: 390 *INNLSNM 413 +NNL NM Sbjct: 7030 KLNNLRNM 7037 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,714,981 Number of Sequences: 27780 Number of extensions: 291583 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -