BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30184 (565 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52400.1 68414.m05913 glycosyl hydrolase family 1 protein / b... 30 0.93 At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) 28 3.7 At2g24130.1 68415.m02883 leucine-rich repeat transmembrane prote... 28 3.7 At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribo... 28 5.0 At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) 28 5.0 At4g33985.1 68417.m04822 expressed protein 27 6.5 >At1g52400.1 68414.m05913 glycosyl hydrolase family 1 protein / beta-glucosidase, putative (BG1) contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to GI:6651430 from [Arabidopsis thaliana] Length = 528 Score = 30.3 bits (65), Expect = 0.93 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 251 WFAPRIHG-NVGKKPYNTFTLDIYKHATNFLKEYLKQHANSPK 376 W + + G +G KP+N LD+Y +L +Y+K + P+ Sbjct: 376 WDSKSVDGYKIGSKPFNG-KLDVYSKGLRYLLKYIKDNYGDPE 417 >At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) Length = 159 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 317 YKHATNFLKEYLKQHANSPKDVQPSGEGKKGSKTIIIQ 430 Y H + Y K+H+N P V P K+G II Q Sbjct: 91 YLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQ 128 >At2g24130.1 68415.m02883 leucine-rich repeat transmembrane protein kinase, putative Length = 980 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = -1 Query: 247 VITCCRIRFN**CVTFSRYKNASKQTFLP*YT*QALNL--LLTLCREVSAGFAKLAIVMP 74 + TC + FN + + + + Y+ + L+L L+ +C +V+ G A L P Sbjct: 722 ITTCSKPGFNALVLPLMPNGSLERHLYPGEYSSKNLDLIQLVNICSDVAEGIAYLHHYSP 781 Query: 73 IKYMSCSLFVSSAML 29 +K + C L S+ +L Sbjct: 782 VKVVHCDLKPSNILL 796 >At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribosomal protein S11, Arabidopsis thaliana,PIR2:C35542 Length = 159 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 317 YKHATNFLKEYLKQHANSPKDVQPSGEGKKGSKTIIIQ 430 Y H + Y K+H+N P V P K+G + I Q Sbjct: 91 YLHFVKKYRRYEKRHSNIPAHVSPCFRVKEGDRVTIGQ 128 >At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) Length = 160 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 317 YKHATNFLKEYLKQHANSPKDVQPSGEGKKGSKTIIIQ 430 Y H + Y K+H+N P V P K+G II Q Sbjct: 91 YLHFVKKYQRYEKRHSNIPAHVSPCFRVKEGDHIIIGQ 128 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +2 Query: 365 NSPKDVQPSGEGKKGSKTIIIQGDSRKHLFEAYKEYGEILEPGVKLMGIQPS 520 +S + GE S TI+ QGD + + K++ +++ VK +P+ Sbjct: 103 SSLSSIASEGENSNSSTTIVDQGDDPETMKLRLKQWAQVVACSVKQFSGEPN 154 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,404,877 Number of Sequences: 28952 Number of extensions: 255121 Number of successful extensions: 545 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -