BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30181 (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 24 1.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.3 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 7.6 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -2 Query: 106 DLRVVLCRGGSDDGSHK 56 DL+++L GG ++GS+K Sbjct: 92 DLKIILSMGGWNEGSYK 108 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.3 Identities = 22/68 (32%), Positives = 28/68 (41%), Gaps = 10/68 (14%) Frame = +1 Query: 118 IRRQPRWSLQLQFRDFQRHRA----------YETGELKEALDDDNKPHVIVAVRGSTVTR 267 IR+QP SL + RD R+ A Y + L + PH ST T Sbjct: 1353 IRQQPDGSLFI--RDVSRNNAGEYSCHVENDYGQDSVTHQLIVNAPPHAPQIALTSTTTN 1410 Query: 268 TLTANLKP 291 +LT LKP Sbjct: 1411 SLTFKLKP 1418 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 7.6 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -3 Query: 471 SIKLITSNKRMWWXFATQS 415 S+K T ++WW F ++ Sbjct: 49 SLKQYTCELKLWWEFCQRN 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,776 Number of Sequences: 336 Number of extensions: 2095 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -