BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30181 (578 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 29 0.37 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 29 0.65 SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces p... 26 3.5 SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 26 4.6 SPAC806.02c |||Par A family ATPase iron cluster assembly protein... 25 6.1 SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces... 25 8.0 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 25 8.0 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 29.5 bits (63), Expect = 0.37 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 422 HNPVLRLHYLNLSREFRSLARGGGDL--RNRFTLSMVSSLVSEVRN 291 HNP L L +SRE SL D + R TL +S+LVS +N Sbjct: 255 HNPSTLLSILPISRELNSLLNRIFDRNPKTRITLPELSTLVSNCKN 300 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 28.7 bits (61), Expect = 0.65 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 226 PHVIVAVRGSTVTRTLTANLKPLRTSLTRLDTMLRVNLFLRSPPPRAKLLNSL 384 P I + G + TLTA+L+ T L+T L+ + PP L++S+ Sbjct: 125 PDSIEGIPGCHIIYTLTASLERATQPPTNLETALQFRVIRTIPPNSLDLMHSV 177 >SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 669 Score = 26.2 bits (55), Expect = 3.5 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +1 Query: 136 WSLQLQFRDFQRHRAYETGELKEALDDDNKPHVIVAVRGSTVTRTLTANLKPLR-TSLTR 312 W L + + Y +E + N+ +VIV + G V T LKPL S ++ Sbjct: 38 WRRFLNYDNNALEAKYNEIITEEVSQEPNQKNVIVGISGLHVVNLPTLTLKPLYWPSASK 97 Query: 313 LDTM 324 DT+ Sbjct: 98 NDTL 101 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.8 bits (54), Expect = 4.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 199 KEALDDDNKPHVIVAVRGSTVTRTLTANLKPLRT 300 KE D+K H++VA GS LT +K L T Sbjct: 22 KERQLTDSKYHILVAATGSVAAIKLTLIVKSLLT 55 >SPAC806.02c |||Par A family ATPase iron cluster assembly protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 608 Score = 25.4 bits (53), Expect = 6.1 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 222 VVVVESLLQLTSFVRTMPLEVSKL*L*APSGLAS 121 + +VESLL TS VR +P++ + + + P G+A+ Sbjct: 140 LTIVESLLSETSTVRDVPIDGAVI-VTTPQGIAT 172 >SPAC32A11.01 |mug8||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.0 bits (52), Expect = 8.0 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 471 SIKLITSNKRMWWXFATQSC 412 S+ +T+N +WW +A C Sbjct: 390 SLTTVTTNTNIWWVWAESRC 409 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 25.0 bits (52), Expect = 8.0 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +1 Query: 142 LQLQFRDFQRHRAYETGELKEALDDDNKPHVIVAVRGSTVTRTLTAN 282 + LQFR + R +L+ DD+N ++ + G+ + T N Sbjct: 426 IMLQFRSLEEERDVLESKLQTLEDDNNSLRLMTSSLGNQIESLRTQN 472 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,962,024 Number of Sequences: 5004 Number of extensions: 34066 Number of successful extensions: 90 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -