BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30180 (546 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 28 0.78 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 1.8 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 4.2 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 4.2 SPBC947.05c |||ferric-chelate reductase |Schizosaccharomyces pom... 25 5.5 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 25 9.6 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 28.3 bits (60), Expect = 0.78 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 465 RVMVHVVGHRPDRRFFAL*RWSPRSLIVDSCSK 367 + +V + PD +FF + W P L + SC K Sbjct: 210 KFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFK 242 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 27.1 bits (57), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 160 RNSEEARTDRPSQQLRTWNGEWQIVSVNILLNS 258 RNS T P Q TW+ W I S+N L +S Sbjct: 426 RNSSLEFTSLPGQSSDTWSIFWNISSLNSLPSS 458 Score = 26.6 bits (56), Expect = 2.4 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +2 Query: 35 PIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIALPN 199 P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L + Sbjct: 172 PRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRLYS 231 Query: 200 SCA 208 S A Sbjct: 232 SDA 234 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 25.8 bits (54), Expect = 4.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 402 SPRSLIVDSCSKLEQHSTLSRSILLI 325 SP +L +CS L HST + L+ Sbjct: 28 SPNNLTEQTCSPLRAHSTFKEPVFLL 53 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 4.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 271 VKSAHFLTNRPKSAKSLINQKNRP 342 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 >SPBC947.05c |||ferric-chelate reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 25.4 bits (53), Expect = 5.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 459 MVHVVGHRPDRRFFAL 412 M+++VG +P R FFAL Sbjct: 274 MIYMVGRKPKRSFFAL 289 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 24.6 bits (51), Expect = 9.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 208 CATVGKGDRCGPLRYYASWRKGDV 137 C V G R GP Y +W+ DV Sbjct: 395 CLFVRNGARLGPTSIYHAWKAFDV 418 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,381,055 Number of Sequences: 5004 Number of extensions: 50032 Number of successful extensions: 104 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -