BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30178 (508 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2873|AAF57567.1| 79|Drosophila melanogaster CG10460-P... 29 4.8 >AE013599-2873|AAF57567.1| 79|Drosophila melanogaster CG10460-PA protein. Length = 79 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 264 EKNPYT-TFGINKFADYTPEEQQSRLGLRLP 353 EK T GIN AD TPEE R G ++P Sbjct: 47 EKGEVTWKMGINHLADLTPEEFAQRCGKKVP 77 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,213,651 Number of Sequences: 53049 Number of extensions: 379588 Number of successful extensions: 1148 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1825511424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -