BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30173 (619 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q88WJ7 Cluster: UPF0122 protein lp_1634; n=43; Bacilli|... 39 0.083 UniRef50_Q2JU59 Cluster: ISSoc4, transposase orfAB; n=18; Synech... 35 1.4 UniRef50_A5ZEP0 Cluster: Putative uncharacterized protein; n=2; ... 34 3.1 UniRef50_Q877K7 Cluster: ISPsy8, transposase OrfA; n=2; Pseudomo... 33 5.5 UniRef50_O05290 Cluster: Probable UPF0122 protein; n=3; Mycoplas... 33 5.5 UniRef50_Q0AUU0 Cluster: Transposase; n=1; Syntrophomonas wolfei... 33 7.2 UniRef50_A0AGR8 Cluster: Complete genome; n=1; Listeria welshime... 33 7.2 UniRef50_A5Z9T7 Cluster: Putative uncharacterized protein; n=2; ... 32 9.5 >UniRef50_Q88WJ7 Cluster: UPF0122 protein lp_1634; n=43; Bacilli|Rep: UPF0122 protein lp_1634 - Lactobacillus plantarum Length = 115 Score = 39.1 bits (87), Expect = 0.083 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 3/74 (4%) Frame = +2 Query: 71 YKRYDPLIL---KTAIEAYEIGNRSLVEIAKQFNISKSVLHRHVTRTMKSQGGHKKRLHN 241 ++ Y+PL+ K I+ Y + SL EIA +F++S+ ++ ++ RT K G++ +LH Sbjct: 13 FEFYEPLLTNKQKAYIQLYYADDYSLGEIAAEFSVSRQAVYDNIKRTEKILEGYEAKLH- 71 Query: 242 KY*YFSEWGYPLDS 283 Y F E + +D+ Sbjct: 72 LYHDFVERNHEVDA 85 >UniRef50_Q2JU59 Cluster: ISSoc4, transposase orfAB; n=18; Synechococcus|Rep: ISSoc4, transposase orfAB - Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacteriumYellowstone A-Prime) Length = 315 Score = 35.1 bits (77), Expect = 1.4 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +2 Query: 107 IEAYEIGNRSLVEIAKQFNISKSVLHRHVTRTMKSQGGHKKRLHNK 244 + AY+ GN S+ ++AK+F ++K +HR V + ++Q K+ K Sbjct: 13 VAAYQAGNTSIRQVAKRFMVTKRTVHRWVRQYQQTQDLAPKKAGTK 58 >UniRef50_A5ZEP0 Cluster: Putative uncharacterized protein; n=2; Bacteroides|Rep: Putative uncharacterized protein - Bacteroides caccae ATCC 43185 Length = 169 Score = 33.9 bits (74), Expect = 3.1 Identities = 16/59 (27%), Positives = 33/59 (55%) Frame = +2 Query: 32 DMPSVCVSKSAKPYKRYDPLILKTAIEAYEIGNRSLVEIAKQFNISKSVLHRHVTRTMK 208 D +C+ K+ K Y+ IL EA I N+ E+A++ N+S + +H+++ + ++ Sbjct: 100 DSRILCIRKAMKKLTPYNYYIL----EACYIHNKKYKEVAEELNVSVAAIHKNIVKALR 154 >UniRef50_Q877K7 Cluster: ISPsy8, transposase OrfA; n=2; Pseudomonas syringae group|Rep: ISPsy8, transposase OrfA - Pseudomonas syringae pv. tomato Length = 171 Score = 33.1 bits (72), Expect = 5.5 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +2 Query: 77 RYDPLILKTAIEAYEIGNRSLVEIAKQFNISKSVLHRHVTRTMKSQG--GHKK 229 +Y T ++AY GN +++ QF+I S+L R V KS G GH+K Sbjct: 3 KYSEQFKLTVVKAYLAGNIGFRKVSSQFSIDSSLLRRWVA-NYKSHGHTGHRK 54 >UniRef50_O05290 Cluster: Probable UPF0122 protein; n=3; Mycoplasma|Rep: Probable UPF0122 protein - Mycoplasma mycoides Length = 113 Score = 33.1 bits (72), Expect = 5.5 Identities = 22/65 (33%), Positives = 34/65 (52%) Frame = +2 Query: 50 VSKSAKPYKRYDPLILKTAIEAYEIGNRSLVEIAKQFNISKSVLHRHVTRTMKSQGGHKK 229 +S+ K YK K E Y + SL EIA +FNISK+ ++ +++T K + Sbjct: 14 LSELFKIYKELLTDKQKQYFELYIDEDLSLSEIADEFNISKTAVYDSISKTSKLLFSLET 73 Query: 230 RLHNK 244 +LH K Sbjct: 74 KLHLK 78 >UniRef50_Q0AUU0 Cluster: Transposase; n=1; Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep: Transposase - Syntrophomonas wolfei subsp. wolfei (strain Goettingen) Length = 92 Score = 32.7 bits (71), Expect = 7.2 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 74 KRYDPLILKTAIEAYEIGNRSLVEIAKQFNISKSVLHRHVTRTMKSQGGH 223 K Y+ K ++ Y GN S E+++Q++I+ S + + V R +Q H Sbjct: 4 KHYEENFKKQIVKIYNQGNHSYRELSEQYDIAPSTVRQWVMRYNNTQSFH 53 >UniRef50_A0AGR8 Cluster: Complete genome; n=1; Listeria welshimeri serovar 6b str. SLCC5334|Rep: Complete genome - Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 /SLCC5334) Length = 188 Score = 32.7 bits (71), Expect = 7.2 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +2 Query: 56 KSAKPYKRYDPLILKTAIEAYEIGNRSLVEIAKQFNISKSVLHRHV 193 K +P K+ D +K + Y NR++ +IAK N+S+ +++H+ Sbjct: 136 KLGRPQKQID---IKKIVTLYTTDNRTVTDIAKLMNLSRPTIYKHL 178 >UniRef50_A5Z9T7 Cluster: Putative uncharacterized protein; n=2; Eubacterium ventriosum ATCC 27560|Rep: Putative uncharacterized protein - Eubacterium ventriosum ATCC 27560 Length = 182 Score = 32.3 bits (70), Expect = 9.5 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +2 Query: 77 RYDPLILKTAIEAYEIGNRSLVEIAKQFNISKS 175 RY K ++AY +G++S+ ++A +FN++KS Sbjct: 4 RYSEDFKKEVVKAYMVGDKSIHQLAVEFNVAKS 36 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,013,650 Number of Sequences: 1657284 Number of extensions: 8474513 Number of successful extensions: 14148 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14146 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44807090004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -