BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30167 (759 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43611| Best HMM Match : FA_desaturase (HMM E-Value=7.6) 29 5.4 SB_17282| Best HMM Match : LRR_1 (HMM E-Value=1.1e-07) 28 7.2 >SB_43611| Best HMM Match : FA_desaturase (HMM E-Value=7.6) Length = 220 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/65 (26%), Positives = 34/65 (52%) Frame = +1 Query: 277 ALFQLHTNLSYCSLLRHFDKAAQHENPLIVSTYHRIAFPVDSAXTALARVRVSNIVRFES 456 +L Q+HT +Y S RH+ + +I+ T + A+P L+++ +++++ E Sbjct: 7 SLIQVHTGYAYPSTHRHYLSKKTQASLIILHTGY--AYPTTHRLLHLSKITQASLIQ-EH 63 Query: 457 REFTY 471 FTY Sbjct: 64 TGFTY 68 >SB_17282| Best HMM Match : LRR_1 (HMM E-Value=1.1e-07) Length = 651 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +1 Query: 214 KVLDSVKVNANLYGLERLPLGALFQLHTNLSYCSLLRHFDKAAQHENPLIVSTYHRIAF 390 K+ + ++ NANL+ L +P+ H L C L D + I S + +I F Sbjct: 164 KIWEHIQQNANLFSLCYIPVNCFIICHCLLQICKLSTSSDHVLPVKITEIYSMFLKIFF 222 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,369,026 Number of Sequences: 59808 Number of extensions: 423847 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -