Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30167
         (759 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g66980.1 68414.m07616 protein kinase family protein / glycero...    28   5.9  

>At1g66980.1 68414.m07616 protein kinase family protein /
           glycerophosphoryl diester phosphodiesterase family
           protein similar to leaf rust resistance kinase Lr10
           GI:1680685 from [Triticum aestivum]; contains Pfam
           profiles PF03009: Glycerophosphoryl diester
           phosphodiesterase family, PF00069: Protein kinase domain
          Length = 1109

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = -2

Query: 107 DVLDAPTTRCNHVIFFCRRKLSVLESRRSGQQHLK 3
           DV+D P    +  I FC   + ++ S   GQ HL+
Sbjct: 398 DVIDCPVQMSSDGIPFCSSSIDLVNSTTVGQTHLR 432


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,834,245
Number of Sequences: 28952
Number of extensions: 291063
Number of successful extensions: 521
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 509
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 521
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1692519896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)