BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30166 (591 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 29 3.8 SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) 29 3.8 SB_55022| Best HMM Match : 7tm_1 (HMM E-Value=0.011) 28 5.0 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 556 VSGYRRPWTSAMPGAEQAAAYRLILSTS 473 +S +RR W +A AE+ AA RL++ T+ Sbjct: 27 ISHFRRVWATAQQLAEETAADRLVILTA 54 >SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) Length = 998 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 554 EWLPSPMDFSNARGRASRCLPLNTLH 477 E+ SPM N +SRCL LNTLH Sbjct: 611 EYHESPMRRHNQSCHSSRCLLLNTLH 636 >SB_55022| Best HMM Match : 7tm_1 (HMM E-Value=0.011) Length = 441 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = -2 Query: 443 SGNISISV*EXRPHSFCLFSPFTVEWFARRSVYFLTLALPKSYIFSLAVTNRSRVKFYSQ 264 +GN +I+ + P +CLF+P+ FA F T+ + S +F ++ + SR +S Sbjct: 54 AGNGAITEFKDAPRIYCLFNPYGE--FALFFALFNTVLVLISAVFIWSILSSSRRTLFSA 111 Query: 263 R 261 R Sbjct: 112 R 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,954,293 Number of Sequences: 59808 Number of extensions: 291629 Number of successful extensions: 548 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -