BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30156 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomy... 29 0.64 SPAC6F6.09 |||NuA4 histone acetyltransferase complex subunit |Sc... 27 2.6 SPBC11C11.02 |imp2||contractile ring protein Imp2|Schizosaccharo... 26 4.5 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 26 4.5 SPBC342.02 |||glutaminyl-tRNA synthetase |Schizosaccharomyces po... 26 6.0 SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharo... 25 7.9 >SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 735 Score = 29.1 bits (62), Expect = 0.64 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 462 NTIQFYDTQPGAARPDLLLGNSRMHFLFTRFILASLV--YMFVTDSFRR 602 N QFY T P + D+L G R H F + S FV ++FRR Sbjct: 257 NLNQFYLTVPLTEKLDILFGFIRTHLKFKTIVFLSSCKQVRFVYETFRR 305 >SPAC6F6.09 |||NuA4 histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 138 Score = 27.1 bits (57), Expect = 2.6 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 4/92 (4%) Frame = -3 Query: 548 CKKEMHSRITQQQIRPSGARLRVIKL-DSIQCLHYTFEMLTLESGPNYAYTSFKQIHELD 372 CKKE+H I ++Q+ + +I L DSI L ++ L SG F+ + + + Sbjct: 21 CKKELHEMIEKRQLLETS----LIGLEDSIYRLEGSY--LEKTSGTGNIIRGFEGLLKNN 74 Query: 371 ALN*R---SYSLSIILFTNCDYDADRYRHPAY 285 A N R YS S LF+ + R PAY Sbjct: 75 ASNLRRRADYSESDRLFSLSSLSSPHTRSPAY 106 >SPBC11C11.02 |imp2||contractile ring protein Imp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 670 Score = 26.2 bits (55), Expect = 4.5 Identities = 16/82 (19%), Positives = 32/82 (39%) Frame = -1 Query: 598 LKESVTNIYTSEANIKRVKRKCIRELPNNRSGRAAPGCVS*NWIVFNVYIIHSRC*HLRV 419 + E + + Y ANI+ K + +L GC+ + V + + HL++ Sbjct: 43 INEELRSFYHERANIEEDYAKRMAKLSRTTFSSLETGCLKESVQVMKAEVDNMAKSHLQI 102 Query: 418 DLTTPTQVSNRYTNWTH*ISDR 353 V N +T + + D+ Sbjct: 103 SQLLQDDVENAFTRYAASLKDK 124 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 122 GGRAHSPPGVNWLLEPIDIYN 184 GG H P V WLL P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 >SPBC342.02 |||glutaminyl-tRNA synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 69 EPVKITYSCSYRDPVYE 19 +P KITYS Y D +YE Sbjct: 327 QPYKITYSSDYFDKLYE 343 >SPAC1F3.01 |rrp6|SPAC3H8.11|exosome subunit Rrp6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 410 YAYTSFKQIHELDALN*RSYSLSIILFTNCDYDADR 303 Y F + L + L+ +L CDYDAD+ Sbjct: 312 YVVNLFDTYYATKVLGFEGHGLAFLLQKYCDYDADK 347 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,848,940 Number of Sequences: 5004 Number of extensions: 57670 Number of successful extensions: 101 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -