BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30156 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 4.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.4 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 194 PSTLRYKVLRSQVTTAAPPFN 256 PS+ YK+ R + A PFN Sbjct: 494 PSSTLYKIARREGIRLAAPFN 514 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +1 Query: 502 GRICCWVIREC 534 G CCWV +C Sbjct: 463 GDTCCWVCDQC 473 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +3 Query: 459 LNTIQFYDTQPGAARPDLLLGNSRMHFLFTRFILASLVYMFVTDS 593 L+ +Q D + + GN ++H+ T + S ++VT S Sbjct: 1371 LSNLQSQDGGDYTCQVENAQGNDKLHYTLTVQVPPSAPVLYVTSS 1415 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +3 Query: 459 LNTIQFYDTQPGAARPDLLLGNSRMHFLFTRFILASLVYMFVTDS 593 L+ +Q D + + GN ++H+ T + S ++VT S Sbjct: 1367 LSNLQSQDGGDYTCQVENAQGNDKLHYTLTVQVPPSAPVLYVTSS 1411 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +1 Query: 502 GRICCWVIREC 534 G CCWV +C Sbjct: 553 GDTCCWVCDQC 563 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,685 Number of Sequences: 438 Number of extensions: 4405 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -