BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30146 (740 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 34 0.14 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 31 0.74 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 31 0.98 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 31 0.98 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 30 2.3 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 30 2.3 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 30 2.3 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 29 4.0 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 29 5.2 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 29 5.2 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 29 5.2 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 29 5.2 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 28 6.9 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 28 6.9 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 28 6.9 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 6.9 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 28 6.9 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 28 6.9 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 28 6.9 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 28 6.9 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 28 6.9 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 6.9 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) 28 6.9 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 28 6.9 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 28 6.9 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 6.9 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) 28 6.9 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 28 6.9 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 28 9.1 SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) 28 9.1 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 28 9.1 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 24 LELVXPPGCRNSARGYCNFFNEIQT 98 LELV PPGCRNS C +EI T Sbjct: 13 LELVDPPGCRNSISKLCKDLDEIWT 37 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.42 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 100 NV*ISLKKLQYPRAEFLQPGGXTSSR 23 N+ + +K P EFLQPGG TSSR Sbjct: 12 NIGLCVKSASSPMIEFLQPGGSTSSR 37 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 24 LELVXPPGCRNSARGYCN 77 LELV PPGCRNS G CN Sbjct: 13 LELVDPPGCRNSIEG-CN 29 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 YP EFLQPGG TSSR Sbjct: 32 YPNIEFLQPGGSTSSR 47 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 31.5 bits (68), Expect = 0.74 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 +L+ P+ EFLQPGG TSSR Sbjct: 46 ELKAPKIEFLQPGGSTSSR 64 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 YP EFLQPGG TSSR Sbjct: 112 YPGIEFLQPGGSTSSR 127 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 88 SLKKLQYPRAEFLQPGGXTSSR 23 S++ L + + EFLQPGG TSSR Sbjct: 85 SMRPLVFGKIEFLQPGGSTSSR 106 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 31.1 bits (67), Expect = 0.98 Identities = 16/23 (69%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 88 SLKKLQYP-RAEFLQPGGXTSSR 23 SL +LQ P EFLQPGG TSSR Sbjct: 218 SLHRLQNPSEIEFLQPGGSTSSR 240 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 PR EFLQPGG TSSR Sbjct: 40 PRIEFLQPGGSTSSR 54 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.1 bits (67), Expect = 0.98 Identities = 14/21 (66%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = -2 Query: 82 KKLQY-PRAEFLQPGGXTSSR 23 +++QY P EFLQPGG TSSR Sbjct: 22 QEIQYNPEIEFLQPGGSTSSR 42 >SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 YP EFLQPGG TSSR Sbjct: 18 YPDIEFLQPGGSTSSR 33 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 31.1 bits (67), Expect = 0.98 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 K Y R EFLQPGG TSSR Sbjct: 20 KAIYARIEFLQPGGSTSSR 38 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 YP EFLQPGG TSSR Sbjct: 21 YPCIEFLQPGGSTSSR 36 >SB_2273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L Y R EFLQPGG TSSR Sbjct: 13 LLYLRIEFLQPGGSTSSR 30 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 85 LKKLQYPRAEFLQPGGXTSSR 23 L K Q+ EFLQPGG TSSR Sbjct: 29 LGKNQFDTIEFLQPGGSTSSR 49 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -2 Query: 82 KKLQYP--RAEFLQPGGXTSSR 23 KKL+Y + EFLQPGG TSSR Sbjct: 17 KKLKYTWQKIEFLQPGGSTSSR 38 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 85 LKKLQYPRAEFLQPGGXTSSR 23 L + +Y EFLQPGG TSSR Sbjct: 2 LVEFEYYHIEFLQPGGSTSSR 22 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS R Sbjct: 13 LELVDPPGCRNSIR 26 >SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 91 ISLKKLQYPRAEFLQPGGXTSSR 23 IS+K+ + EFLQPGG TSSR Sbjct: 37 ISVKEHHWLYIEFLQPGGSTSSR 59 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P+ EFLQPGG TSSR Sbjct: 6 PKIEFLQPGGSTSSR 20 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS R Sbjct: 13 LELVDPPGCRNSIR 26 >SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) Length = 157 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 88 SLKKLQYPRAEFLQPGGXTSSR 23 +L+K+ EFLQPGG TSSR Sbjct: 25 NLQKVTIDNIEFLQPGGSTSSR 46 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 24 LELVXPPGCRNSARG 68 LELV PPGCRNS G Sbjct: 89 LELVDPPGCRNSIAG 103 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 +P EFLQPGG TSSR Sbjct: 25 WPEIEFLQPGGSTSSR 40 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 24 LELVXPPGCRNSARG 68 LELV PPGCRNS G Sbjct: 100 LELVDPPGCRNSITG 114 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/23 (69%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -2 Query: 88 SLKKLQYPRA-EFLQPGGXTSSR 23 SL L P A EFLQPGG TSSR Sbjct: 3 SLNMLSAPGAIEFLQPGGSTSSR 25 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 24 LELVXPPGCRNSARGYCNFFNE 89 LELV PPGCRNS FN+ Sbjct: 13 LELVDPPGCRNSMSNPFAAFNQ 34 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 24 LELVXPPGCRNSARG 68 LELV PPGCRNS G Sbjct: 30 LELVDPPGCRNSIDG 44 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 Query: 24 LELVXPPGCRNSARGY 71 LELV PPGCRNS Y Sbjct: 13 LELVDPPGCRNSMEMY 28 >SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 85 LKKLQYPRAEFLQPGGXTSSR 23 + KLQ EFLQPGG TSSR Sbjct: 3 IDKLQNLDIEFLQPGGSTSSR 23 >SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -2 Query: 82 KKLQYPRAEFLQPGGXTSSR 23 +K++ R EFLQPGG TSSR Sbjct: 62 EKVKKYRIEFLQPGGSTSSR 81 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 + R EFLQPGG TSSR Sbjct: 48 FSRIEFLQPGGSTSSR 63 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 109 PNIEFLQPGGSTSSR 123 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 24 LELVXPPGCRNSARG 68 LELV PPGCRNS G Sbjct: 13 LELVDPPGCRNSMIG 27 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 9 PNIEFLQPGGSTSSR 23 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 24 LELVXPPGCRNSARGYCNFFNEIQTL 101 LELV PPGCRNS + ++ T+ Sbjct: 13 LELVDPPGCRNSINTINHIYHVTNTI 38 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 24 LELVXPPGCRNSARGYCNFFNE 89 LELV PPGCRNS C N+ Sbjct: 13 LELVDPPGCRNSI-AQCRVLNK 33 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 88 SLKKLQYPRAEFLQPGGXTSSR 23 +LK + EFLQPGG TSSR Sbjct: 93 ALKSCPFQWIEFLQPGGSTSSR 114 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 K + + EFLQPGG TSSR Sbjct: 24 KFNFCKIEFLQPGGSTSSR 42 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 3 PEIEFLQPGGSTSSR 17 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 82 KKLQYPRAEFLQPGGXTSSR 23 K + P EFLQPGG T SR Sbjct: 80 KSMSSPNIEFLQPGGSTRSR 99 >SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 K Y EFLQPGG TSSR Sbjct: 9 KTIYKNIEFLQPGGSTSSR 27 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 55 PNIEFLQPGGSTSSR 69 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 23 PSIEFLQPGGSTSSR 37 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSMK 26 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 146 PAIEFLQPGGSTSSR 160 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSMK 26 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 24 LELVXPPGCRNSARGYCN 77 LELV PPGCRNS N Sbjct: 13 LELVDPPGCRNSIAADAN 30 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 24 LELVXPPGCRNSARGY 71 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSIEDF 28 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 88 SLKKLQYPRAEFLQPGGXTSSR 23 ++++ Y EFLQPGG TSSR Sbjct: 12 NIEENNYTLIEFLQPGGSTSSR 33 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 68 LELVDPPGCRNSMK 81 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSIK 26 >SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L+ P EFLQPGG TSSR Sbjct: 14 LRDPIIEFLQPGGSTSSR 31 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/27 (59%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 100 NV*ISLKKLQY-PRAEFLQPGGXTSSR 23 N+ I L Y P EFLQPGG TSSR Sbjct: 12 NILIPLTYPYYTPPIEFLQPGGSTSSR 38 >SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 71 PTIEFLQPGGSTSSR 85 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 13 PTIEFLQPGGSTSSR 27 >SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 KL EFLQPGG TSSR Sbjct: 16 KLSQGNIEFLQPGGSTSSR 34 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 24 LELVXPPGCRNSAR 65 LELV PPGCRNS + Sbjct: 13 LELVDPPGCRNSMK 26 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 16 RIEFLQPGGSTSSR 29 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 19 RIEFLQPGGSTSSR 32 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L P EFLQPGG TSSR Sbjct: 72 LNPPCIEFLQPGGSTSSR 89 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 33 LELVDPPGCRNS 44 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 5 RIEFLQPGGSTSSR 18 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 40 PDIEFLQPGGSTSSR 54 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 139 RIEFLQPGGSTSSR 152 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 89 LELVDPPGCRNS 100 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 657 LELVDPPGCRNS 668 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 16 RIEFLQPGGSTSSR 29 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 30 LELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 70 LELVDPPGCRNS 81 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 228 RIEFLQPGGSTSSR 241 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 12 PPIEFLQPGGSTSSR 26 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 2 RIEFLQPGGSTSSR 15 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 7 PYIEFLQPGGSTSSR 21 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 64 RIEFLQPGGSTSSR 77 >SB_49997| Best HMM Match : UCR_TM (HMM E-Value=1.1) Length = 91 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 2 PYIEFLQPGGSTSSR 16 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 10 RIEFLQPGGSTSSR 23 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) Length = 141 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 17 RIEFLQPGGSTSSR 30 >SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 7 RIEFLQPGGSTSSR 20 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 24 RIEFLQPGGSTSSR 37 >SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 78 RIEFLQPGGSTSSR 91 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 50 LELVDPPGCRNS 61 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 19 RIEFLQPGGSTSSR 32 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 64 RIEFLQPGGSTSSR 77 >SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) Length = 133 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 82 KKLQYPRAEFLQPGGXTSSR 23 K ++ EFLQPGG TSSR Sbjct: 39 KSIEVAYIEFLQPGGSTSSR 58 >SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 26 RIEFLQPGGSTSSR 39 >SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 12 RIEFLQPGGSTSSR 25 >SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 K + EFLQPGG TSSR Sbjct: 4 KASFQMIEFLQPGGSTSSR 22 >SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 15 RIEFLQPGGSTSSR 28 >SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 44 RIEFLQPGGSTSSR 57 >SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 Y EFLQPGG TSSR Sbjct: 17 YNNIEFLQPGGSTSSR 32 >SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 4 RIEFLQPGGSTSSR 17 >SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 64 RAEFLQPGGXTSSR 23 R EFLQPGG TSSR Sbjct: 3 RIEFLQPGGSTSSR 16 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 100 LELVDPPGCRNS 111 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 24 LELVXPPGCRNS 59 LELV PPGCRNS Sbjct: 76 LELVDPPGCRNS 87 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 32 PDIEFLQPGGSTSSR 46 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 Y EFLQPGG TSSR Sbjct: 25 YDDIEFLQPGGSTSSR 40 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L+ + EFLQPGG TSSR Sbjct: 65 LRVRKIEFLQPGGSTSSR 82 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L Y EFLQPGG TSSR Sbjct: 35 LTYIIIEFLQPGGSTSSR 52 >SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) Length = 177 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 + ++ EFLQPGG TSSR Sbjct: 146 RAEFEAIEFLQPGGSTSSR 164 >SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L Y EFLQPGG TSSR Sbjct: 20 LGYLYIEFLQPGGSTSSR 37 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/22 (68%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -2 Query: 82 KKLQYPRA--EFLQPGGXTSSR 23 KKL P EFLQPGG TSSR Sbjct: 8 KKLCMPTVNIEFLQPGGSTSSR 29 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 27.9 bits (59), Expect = 9.1 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -2 Query: 127 FVFNIQC*INV*-ISLKKL-QYPRAEFLQPGGXTSSR 23 F N C + V SLK+ + + EFLQPGG TSSR Sbjct: 3 FFLNSYCILRVSRCSLKETPELYQIEFLQPGGSTSSR 39 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L + + EFLQPGG TSSR Sbjct: 13 LIHQKIEFLQPGGSTSSR 30 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 20 PIIEFLQPGGSTSSR 34 >SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 Y EFLQPGG TSSR Sbjct: 2 YVMIEFLQPGGSTSSR 17 >SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/19 (68%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -2 Query: 76 LQYP-RAEFLQPGGXTSSR 23 +QY + EFLQPGG TSSR Sbjct: 4 IQYTEKIEFLQPGGSTSSR 22 >SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 67 PRAEFLQPGGXTSSR 23 P EFLQPGG TSSR Sbjct: 15 PWIEFLQPGGSTSSR 29 >SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 KL+ EFLQPGG TSSR Sbjct: 4 KLREYSIEFLQPGGSTSSR 22 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 76 LQYPRAEFLQPGGXTSSR 23 L + + EFLQPGG TSSR Sbjct: 402 LLHSQIEFLQPGGSTSSR 419 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 464 CLRGIVTXSITL--HFTPHFICVESENIXKHSXXXXXXYWSYRDVCIAYSL 610 C+R I+ L H P ++ + E+I K + SY D+C+ Y + Sbjct: 644 CVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIASPAMSYSDICVNYGI 694 >SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 5/28 (17%) Frame = -2 Query: 91 ISLKKLQYPRA-----EFLQPGGXTSSR 23 +SL+ +Y R EFLQPGG TSSR Sbjct: 1 MSLRNYEYKRKLLDWIEFLQPGGSTSSR 28 >SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 70 YPRAEFLQPGGXTSSR 23 Y EFLQPGG TSSR Sbjct: 3 YLNIEFLQPGGSTSSR 18 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 79 KLQYPRAEFLQPGGXTSSR 23 K + + EFLQPGG TSSR Sbjct: 24 KTRSAKIEFLQPGGSTSSR 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,501,940 Number of Sequences: 59808 Number of extensions: 295336 Number of successful extensions: 1086 Number of sequences better than 10.0: 145 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1086 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -