BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30141 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 26 0.96 AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcrip... 26 0.96 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 26.2 bits (55), Expect = 0.96 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 386 FSWSVWYLLPQSAFQYEHVF*HKTTYISNL*YHLELYIYIN 508 FS +W + P++ F E + K T + L + ++ YIN Sbjct: 389 FSMFLWLISPKNVFHGERISRLKKTTLGGLIAFVYIFAYIN 429 >AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcription factor protein. Length = 185 Score = 26.2 bits (55), Expect = 0.96 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 414 HNLHFNMSMFSNIKQHIFQICDIILNYIY 500 HN ++ M +SN QH FQ I + +Y Sbjct: 138 HNQYYYMQNYSNYSQHNFQTAGPISSGLY 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 577,906 Number of Sequences: 2352 Number of extensions: 10600 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -