BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30141 (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 4.7 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 4.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.3 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 549 NQNIHLIHTYFKLQFIYIYSS 487 N +I IH+ F + I+IYS+ Sbjct: 4 NFSIMFIHSIFLILIIFIYSN 24 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 549 NQNIHLIHTYFKLQFIYIYSS 487 N +I IH+ F + I+IYS+ Sbjct: 4 NFSIMFIHSIFLILIIFIYSN 24 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 600 KVQKSYSTTNKGAKNMVNQNIHLIHTYFKLQFIYI 496 + ++ S K +++N IH + Y KLQ+ I Sbjct: 292 RTERERSREPKIISSLLNNTIHNNNNYKKLQYYNI 326 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 600 KVQKSYSTTNKGAKNMVNQNIHLIHTYFKLQFIYI 496 + ++ S K +++N IH + Y KLQ+ I Sbjct: 303 RTERERSREPKIISSLLNNTIHNNNNYKKLQYYNI 337 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 600 KVQKSYSTTNKGAKNMVNQNIHLIHTYFKLQFIYI 496 + ++ S K +++N IH + Y KLQ+ I Sbjct: 303 RTERERSREPKIISSLLNNTIHNNNNYKKLQYYNI 337 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 600 KVQKSYSTTNKGAKNMVNQNIHLIHTYFKLQFIYI 496 + ++ S K +++N IH + Y KLQ+ I Sbjct: 292 RTERERSREPKIISSLLNNTIHNNNNYKKLQYYNI 326 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,992 Number of Sequences: 438 Number of extensions: 3132 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -