BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30138 (419 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 28 0.51 SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual 26 2.7 SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual 25 3.6 SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ... 25 4.8 SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosacchar... 25 4.8 SPBC18E5.03c |sim4||kinetochore protein Sim4 |Schizosaccharomyce... 25 6.3 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 25 6.3 SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe... 24 8.4 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 28.3 bits (60), Expect = 0.51 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 119 ILQHRRPRLPLMQLEAPCSFNFCSLRA 39 I Q LP + L +PCSF CSLRA Sbjct: 48 IAQKSNISLPFLTL-SPCSFTICSLRA 73 >SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 2.7 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 121 WHW-GSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 228 W W GSVD SG N R S TS+LR+ Sbjct: 39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQ 75 >SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual Length = 653 Score = 25.4 bits (53), Expect = 3.6 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -1 Query: 206 QRLCFLPLFPLS*NRAREPLMESTDPQCHILQHRRPRLPLMQLEAP 69 +++ FL L PLS ++ + ++P+ +QH++ L ++L P Sbjct: 135 RKMQFLSLEPLSLLLLKDSFINKSNPEYESMQHQQILLKKLKLHFP 180 >SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 25.0 bits (52), Expect = 4.8 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -1 Query: 146 MESTDPQCHILQHRRPRLPLMQLEAPCSF 60 M+S Q ++L RP LPL P F Sbjct: 88 MDSLSHQIYLLHKNRPTLPLKPTNQPTRF 116 >SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 25.0 bits (52), Expect = 4.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 303 TSPVLDIAPGSDLFCFIWN*NA 368 T P+ + P ++FC IW+ NA Sbjct: 411 THPLRSVIPLDNIFCNIWSDNA 432 >SPBC18E5.03c |sim4||kinetochore protein Sim4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 24.6 bits (51), Expect = 6.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 403 LHRIDKFIKNLNAF*FQIKQKRSDPGAMSRTG 308 LH+I KF +L + + +++ AMSR G Sbjct: 119 LHQIKKFSSDLQSLKSSMGERQKQQAAMSRRG 150 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 24.6 bits (51), Expect = 6.3 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 52 QKLKEHGASSCISGKRGRRCCNIWHWGS 135 Q E A +C G G C +W+W + Sbjct: 394 QSSAEAAALACSGGSDGVTCGYMWYWNN 421 >SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 830 Score = 24.2 bits (50), Expect = 8.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 327 ERCRERVMFSITSWRGGYHGSSSQRDT 247 E R+RV FS+TS G SSQ+ + Sbjct: 77 EESRKRVSFSLTSNDGAKSDRSSQKSS 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,607,295 Number of Sequences: 5004 Number of extensions: 28514 Number of successful extensions: 54 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 148351622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -