BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30136 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.6 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 24 1.6 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 24 1.6 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 24 1.6 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.9 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 8.7 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 8.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.7 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 348 IRVTDQADSPFVGSRFEQSW*IPWSSLPP 434 ++ TD+ D+ + G+RF + IP LPP Sbjct: 423 VQETDKYDA-YYGNRFSGEYEIPAHGLPP 450 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 394 LNKAGKFPGLLSHQE 438 LNK GK P L++H+E Sbjct: 573 LNKIGKNPNLVAHRE 587 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 394 LNKAGKFPGLLSHQE 438 LNK GK P L++H+E Sbjct: 541 LNKIGKNPNLVAHRE 555 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/51 (25%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 584 HKEVDGKM-HILSKLIRSHVHMANCYKRHNTFFIWNLMVPLTSSIFCVMDS 435 H +G + HIL K + + CYK + + + C MDS Sbjct: 299 HTSFNGMLSHILQKTTLNMLTQVECYKYYGNIMVNAMCAYAKGKDACQMDS 349 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -3 Query: 321 QFLDKLFVLIQFFQSLSIHTWHIKVLASSQCCWSP 217 Q L KL + + +H+W + S W P Sbjct: 74 QLLPKLMEFDDWTSVMELHSWMTLMWTDSHLSWKP 108 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 519 GHVDMTPDELAQNVHLSINFLVS 587 G ++TPD+ ++VH I VS Sbjct: 79 GTRELTPDDFTEDVHEIIEQCVS 101 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 519 GHVDMTPDELAQNVHLSINFLVS 587 G ++TPD+ ++VH I VS Sbjct: 79 GTRELTPDDFTEDVHEIIEQCVS 101 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 Query: 252 KVLASSQCCW 223 K +A QCCW Sbjct: 598 KYVAGEQCCW 607 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,757 Number of Sequences: 438 Number of extensions: 4033 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -