BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30134 (590 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 27 2.7 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 25 6.2 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 26.6 bits (56), Expect = 2.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 168 FYFVARRVDSFFISFQFEALLSTDRGRVMNCTFYY 272 F FV + D ISF +L S + G+V+ C F Y Sbjct: 2159 FLFVGPKNDYNRISFSSASLSSGEDGKVVPCMFSY 2193 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 25.4 bits (53), Expect = 6.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 159 RDWFYFVARRVDSFFISFQF 218 R+W++F+ R SFF F F Sbjct: 58 RNWWFFIKMRYLSFFFEFFF 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,041,000 Number of Sequences: 5004 Number of extensions: 37028 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -