SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30130
         (642 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    24   1.4  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    21   7.7  

>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = -1

Query: 261 ISHLILVIFYIIVYKQMNFILRIISINDLI 172
           +S+ I  + Y   +  +NF + I ++NDLI
Sbjct: 379 VSNRIQKVIYGFDFNDVNFRILIANVNDLI 408


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = -3

Query: 91  ESFSLYTAHSPHS 53
           E ++LYTA +PH+
Sbjct: 771 EHYALYTAMAPHA 783


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,660
Number of Sequences: 438
Number of extensions: 3223
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19315974
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -