BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30129 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 43 2e-04 SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) 41 8e-04 SB_46304| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 39 0.002 SB_45116| Best HMM Match : EGF (HMM E-Value=0) 38 0.006 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_37565| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) 36 0.017 SB_3431| Best HMM Match : EGF (HMM E-Value=1.8e-08) 36 0.017 SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_55345| Best HMM Match : Laminin_G_2 (HMM E-Value=2e-31) 36 0.030 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 36 0.030 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 35 0.040 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 35 0.040 SB_6531| Best HMM Match : EGF_2 (HMM E-Value=0.0016) 35 0.053 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 34 0.070 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.070 SB_56964| Best HMM Match : Zona_pellucida (HMM E-Value=0) 34 0.093 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 34 0.093 SB_32940| Best HMM Match : EGF (HMM E-Value=0) 34 0.093 SB_40116| Best HMM Match : EGF (HMM E-Value=0) 33 0.12 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 33 0.16 SB_3456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_2045| Best HMM Match : EGF (HMM E-Value=0) 33 0.16 SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 32 0.28 SB_39056| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_34555| Best HMM Match : EGF (HMM E-Value=7.00649e-45) 32 0.28 SB_54457| Best HMM Match : EGF (HMM E-Value=4.6e-31) 32 0.38 SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_50568| Best HMM Match : EGF (HMM E-Value=0) 32 0.38 SB_34553| Best HMM Match : F5_F8_type_C (HMM E-Value=8.3e-22) 32 0.38 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_3977| Best HMM Match : EGF (HMM E-Value=1.8e-09) 32 0.38 SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 31 0.50 SB_5993| Best HMM Match : EGF_2 (HMM E-Value=9e-14) 31 0.50 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 31 0.50 SB_825| Best HMM Match : EGF (HMM E-Value=5.6e-08) 31 0.50 SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) 31 0.66 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_22952| Best HMM Match : EGF_2 (HMM E-Value=2e-23) 31 0.66 SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 31 0.66 SB_58558| Best HMM Match : EGF (HMM E-Value=0) 30 1.1 SB_22957| Best HMM Match : EGF (HMM E-Value=7e-39) 30 1.1 SB_15072| Best HMM Match : EGF (HMM E-Value=5.8e-08) 30 1.1 SB_9507| Best HMM Match : Cadherin (HMM E-Value=0) 30 1.1 SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) 30 1.1 SB_42888| Best HMM Match : EGF (HMM E-Value=8.4e-20) 30 1.1 SB_20264| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_16748| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_3578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_2152| Best HMM Match : EGF (HMM E-Value=0) 30 1.1 SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_36893| Best HMM Match : Fibrinogen_C (HMM E-Value=2.4e-24) 29 2.0 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 29 2.0 SB_9474| Best HMM Match : EGF (HMM E-Value=2e-08) 29 2.0 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_52863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_48559| Best HMM Match : Peptidase_A17 (HMM E-Value=2e-38) 29 2.6 SB_39963| Best HMM Match : EGF (HMM E-Value=1.4e-13) 29 2.6 SB_38959| Best HMM Match : EGF (HMM E-Value=0.14) 29 2.6 SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) 29 2.6 SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) 29 2.6 SB_58992| Best HMM Match : VWA (HMM E-Value=2.4e-15) 29 2.6 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 29 2.6 SB_24004| Best HMM Match : EGF (HMM E-Value=5.7e-14) 29 2.6 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 29 3.5 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 29 3.5 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_45954| Best HMM Match : VWA (HMM E-Value=4e-26) 29 3.5 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_24015| Best HMM Match : I-set (HMM E-Value=2.7e-21) 29 3.5 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_22511| Best HMM Match : EGF (HMM E-Value=0.053) 29 3.5 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 29 3.5 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 29 3.5 SB_8544| Best HMM Match : EGF (HMM E-Value=0.053) 29 3.5 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 29 3.5 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 29 3.5 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 29 3.5 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 29 3.5 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 29 3.5 SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 29 3.5 SB_9022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_53139| Best HMM Match : EGF (HMM E-Value=3.2e-08) 28 4.6 SB_44887| Best HMM Match : EGF (HMM E-Value=4.1e-09) 28 4.6 SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 28 4.6 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 28 6.1 SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 6.1 SB_29802| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 6.1 SB_54456| Best HMM Match : EGF (HMM E-Value=2.3e-31) 28 6.1 SB_54230| Best HMM Match : EGF (HMM E-Value=0) 28 6.1 SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) 28 6.1 SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 28 6.1 SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 28 6.1 SB_19665| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) 27 8.1 SB_47132| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 SB_2059| Best HMM Match : PAN (HMM E-Value=0.024) 27 8.1 SB_703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/54 (42%), Positives = 34/54 (62%) Frame = +1 Query: 28 FTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIARLADSVSMKIN 189 F SL +++G+LE+RY+ G G + + SD LP N+ I IQIAR V + +N Sbjct: 2073 FASLAMKDGKLEYRYNTGQG--VIKVASDTALPLNKPIAIQIARDGLRVVLTVN 2124 >SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1747 Score = 40.7 bits (91), Expect = 8e-04 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +2 Query: 314 GFSGCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGGSCS---TEST 484 GF GC++++ N N D+ + +K N E G AS +C+N G C + Sbjct: 1203 GFKGCVRNIKDNHNLYDLKNPLKVVNAPE------GCQLASACPECKNDGYCEPLMARDS 1256 Query: 485 NCICPPGY 508 C+C PGY Sbjct: 1257 ICVCNPGY 1264 Score = 31.9 bits (69), Expect = 0.38 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 311 GGFSGCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGGSC-STESTN 487 G F GCI +N ++ + SIK + N D ++ C NGG+C Sbjct: 1485 GDFGGCIAGTSVNGANMESDPSIK---VHRQNVLDGCPCLSN---FCANGGTCVDAMPPY 1538 Query: 488 CICPPGY 508 CIC PG+ Sbjct: 1539 CICAPGW 1545 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/61 (22%), Positives = 27/61 (44%) Frame = +1 Query: 7 SSRGYGGFTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIARLADSVSMKI 186 ++ G F ++ +R GR+E LG V + L +W +Q+ R + + I Sbjct: 1083 ANNGLKDFIAVVLRGGRVELFVSLGLDPVTVKMDKGPRLDDGEWHTVQVLRNMKDIEIII 1142 Query: 187 N 189 + Sbjct: 1143 D 1143 >SB_46304| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 645 Score = 39.1 bits (87), Expect = 0.002 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = +2 Query: 314 GFSGCIKDVVLNSNAVD-INSSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTN- 487 GF GCI DV ++ N +D INS +K I++C + + C N G+C Sbjct: 395 GFKGCISDVAVDDNPIDLINSYVKHRGIEQCTEC----LLPCQIEPCVNNGTCIPRGQTG 450 Query: 488 --CICPPGY 508 C C G+ Sbjct: 451 YMCACGDGF 459 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +1 Query: 22 GGFTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIARLADSVSMKIN 189 G + S + +G EFR+DLGS P ++ S + L QW + + R +++++ Sbjct: 84 GDYISFGMSDGFAEFRFDLGSAG-PAIIRSHQQLTLYQWYTVVLTRQESEGTLQVD 138 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 22 GGFTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQW 138 G F S+ + G +EFRYDLG G V+ S + + QW Sbjct: 299 GDFVSIAIVGGNVEFRYDLGYGR--AVIRSKKNITVGQW 335 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S QC NGG+C+ NC CPPGY Sbjct: 1108 DINECASNQCVNGGTCTDLVNGFNCTCPPGY 1138 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGYRDRT 520 DI S C NGG+C+ NC CPPGY T Sbjct: 238 DIDECASNPCINGGTCTDMVNGYNCTCPPGYNGTT 272 Score = 36.3 bits (80), Expect = 0.017 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGYR 511 DI S C NGG+C+ NC CPPGY+ Sbjct: 314 DINECASNPCVNGGTCADLVNGFNCTCPPGYK 345 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGYRDRT 520 DI S C NGG+C+ NC CPPGY T Sbjct: 276 DINECASNPCLNGGTCNDLVNGYNCNCPPGYNGTT 310 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S C NGG+C+ +C CPPGY Sbjct: 983 DINECASNPCVNGGTCTDLVNGFHCTCPPGY 1013 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S C NGG+C+ +C CPPGY Sbjct: 1184 DINECASNPCVNGGTCTDLVNGFHCTCPPGY 1214 Score = 32.3 bits (70), Expect = 0.28 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGYRDRT 520 DI S C NGG+C+ NC C PGY T Sbjct: 1070 DINECASNPCLNGGTCNDLVNGYNCKCQPGYNGTT 1104 Score = 31.9 bits (69), Expect = 0.38 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTN---CICPPGYRDRTARRALHP 541 DI S C NGG+C TE N C C PGY L P Sbjct: 1222 DIDECASNPCINGGTC-TELVNGFKCTCVPGYNGTRCEIVLRP 1263 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGY 508 DI +S C NGG+C+ + S +C C GY Sbjct: 1021 DINECDSNPCANGGTCADQVNSFSCTCVSGY 1051 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGY 508 +I+ S C+NGGSC + C C GY Sbjct: 162 EIKECTSAPCQNGGSCVDRRDGYTCTCEAGY 192 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 +I +S C NGG+C+ C+C GY Sbjct: 200 EINECDSGPCNNGGTCTDRVNGYECVCNAGY 230 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGY 508 +I E+ C NGG+C+ + S +C C GY Sbjct: 1146 NINECENNPCVNGGTCADQVNSFSCTCVSGY 1176 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 36.7 bits (81), Expect = 0.013 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 Query: 437 ESCQCENGGSCSTESTNCICP 499 +SC C+NGG+C++ S +C CP Sbjct: 531 DSCGCQNGGTCNSTSRSCTCP 551 Score = 30.7 bits (66), Expect = 0.87 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 371 SSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTNCIC 496 S +K N E D+ S C+NGG+CS S+ +C Sbjct: 4983 SRLKERNPAELKGLIAQDLDPCASSPCKNGGTCSKLSSGYVC 5024 >SB_37565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 36.7 bits (81), Expect = 0.013 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 425 IQASESCQCENGGSCSTESTN--CICPPGYRDRTARR 529 I ES C+NGG+C+ + N C C PGY R + Sbjct: 2 INKCESSPCKNGGNCTDQVNNYICTCQPGYTGRNCEK 38 Score = 31.1 bits (67), Expect = 0.66 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +2 Query: 437 ESCQCENGGSCSTESTN--CICPPGY 508 ESC C+NGGS + + C C PGY Sbjct: 97 ESCPCKNGGSYTDRFNDYTCKCQPGY 122 >SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) Length = 635 Score = 36.3 bits (80), Expect = 0.017 Identities = 13/63 (20%), Positives = 28/63 (44%) Frame = +2 Query: 323 GCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTNCICPP 502 GC + V + + + + + T R D+ + +C+C+N +C + C C Sbjct: 103 GCAQGVCVKPDNCTCHPGYDGPSCDQACTLGRWDVNCNNTCECQNNSTCDSVQGICNCTS 162 Query: 503 GYR 511 G++ Sbjct: 163 GWQ 165 >SB_3431| Best HMM Match : EGF (HMM E-Value=1.8e-08) Length = 480 Score = 36.3 bits (80), Expect = 0.017 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +2 Query: 371 SSIKSSNIQECNTYD-RGDIQASESCQCENGGSCSTESTN--CICPPGYRDRTARRA 532 S+ + N E Y +I +S C+NGG+C+ + N C C PGY R A Sbjct: 175 SNCYTVNASEARQYFVPNEINECDSSPCKNGGNCTDQVNNYTCTCQPGYTGRNCEIA 231 >SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1286 Score = 35.5 bits (78), Expect = 0.030 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 449 CENGGSCSTESTN-CICPPGYRDRTARRA 532 CENGG+C +N C CPP +R T ++A Sbjct: 442 CENGGTCIDPVSNTCQCPPNWRGATCKQA 470 >SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1931 Score = 35.5 bits (78), Expect = 0.030 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 6/75 (8%) Frame = +2 Query: 323 GCIKDVVLNSN-AVDINSSIKSSNIQEC--NTYDRGDIQASESCQCEN---GGSCSTEST 484 G + V ++N A +++ N C NT++ E C+C G SC+ + Sbjct: 1234 GAVTSVCNHTNGACQCKANVIGPNCSTCKPNTWNFNSCLGCEDCECAEASLGQSCNVRTG 1293 Query: 485 NCICPPGYRDRTARR 529 C+C PG R R Sbjct: 1294 QCLCKPGATGRRCER 1308 >SB_55345| Best HMM Match : Laminin_G_2 (HMM E-Value=2e-31) Length = 189 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +1 Query: 22 GGFTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIARLADSVSMKIN 189 G + S + +G EFR+DLGS P ++ S + L QW + + R +++++ Sbjct: 75 GDYISFGMSDGFAEFRFDLGSAG-PAIIRSHQQLTLYQWYTVVLTRQESEGTLQVD 129 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 35.5 bits (78), Expect = 0.030 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 7/71 (9%) Frame = +2 Query: 314 GFSGCIKDVVLNSNAVDINSS----IKSSNIQECNTYDRGDIQASESCQCENGGSCSTES 481 GF+GC+K V++ +D++ + +KS ++EC S C+C + C Sbjct: 458 GFTGCVKSFVVDGRMLDLSQALGDVVKSRQVEECG--------ESRDCECHHNAPCHYAV 509 Query: 482 TN---CICPPG 505 + C CP G Sbjct: 510 SGEPICACPLG 520 Score = 34.3 bits (75), Expect = 0.070 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 299 RRRQGGFSGCIKDVVLNSNAVDINSSIKS-SNIQECNTY 412 RR G GC+KD+++ VD+ S + S N++ C+ Y Sbjct: 859 RRFMSGLVGCLKDLIVGDVPVDLASEVTSGQNVRPCSAY 897 Score = 30.7 bits (66), Expect = 0.87 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 28 FTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIAR 159 F +L +RNG +EFR+ G+ V S + + NQW ++ + R Sbjct: 364 FLALGLRNGHVEFRFSCGADIAQV--RSRQNITLNQWHNVVVFR 405 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 1 AESSRGYGGFTSLTVRNGRLEFRYDLGSG 87 ++ G F SL++R G +EF +D GSG Sbjct: 575 SQKKDGKTDFISLSLREGIVEFIFDCGSG 603 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 35.1 bits (77), Expect = 0.040 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTN--CICPPG 505 +I ES C+NGG+C + CICPPG Sbjct: 451 EIDECESSPCQNGGTCKDKINGYVCICPPG 480 Score = 30.7 bits (66), Expect = 0.87 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +2 Query: 425 IQASESCQCENGGSCSTE--STNCICPPGYRDRTARRALHP 541 I S C++GG+CS S +C C PGY T HP Sbjct: 680 INECSSDPCQHGGTCSDRIGSYSCYCRPGY---TGSNCQHP 717 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 2/22 (9%) Frame = +2 Query: 446 QCENGGSCSTE--STNCICPPG 505 +C++GG+C + S CICPPG Sbjct: 192 RCQHGGTCVDKIGSYTCICPPG 213 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 35.1 bits (77), Expect = 0.040 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 392 IQECNTYDRGDIQASESCQCENGGSCSTESTNCICPPGY 508 I EC T G + ++ CQC NG SC + +C C G+ Sbjct: 210 IDECPTGYYG-YECTQKCQCVNGASCDRRTGSCNCTVGW 247 Score = 33.9 bits (74), Expect = 0.093 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 434 SESCQCENGGSCSTESTNCICPPGYR-DRTARR 529 + +CQC G C S C C PG+ DR R Sbjct: 416 TNTCQCSRNGECDAASGRCACAPGFTGDRCESR 448 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 392 IQECNTYDRGDIQASESCQCENGGSCSTESTNCICPPGY 508 +++C GD Q + C+C+N C C+C PGY Sbjct: 771 LEQCPEGRYGD-QCARKCECDNRVPCRATDGVCLCLPGY 808 Score = 33.5 bits (73), Expect = 0.12 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 434 SESCQCENGGSCSTESTNCICPPGY 508 ++ C CENG C ++ C C PG+ Sbjct: 909 TQRCLCENGAKCDRKTGACTCAPGF 933 Score = 31.9 bits (69), Expect = 0.38 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 440 SCQCENGGSCSTESTNCICPPGYRDR 517 +C C NG C + C CP GY+ + Sbjct: 868 NCTCLNGAQCDHVTGTCTCPVGYKGK 893 Score = 31.1 bits (67), Expect = 0.66 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 443 CQCENGGSCSTESTNCICPPGYRDRT 520 C C GSC + + C C PGY T Sbjct: 183 CTCSEYGSCDSRTGKCHCMPGYSGPT 208 Score = 31.1 bits (67), Expect = 0.66 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 425 IQASESCQCENGGSCSTESTNCICPPGY 508 I + C C NG C S C C PG+ Sbjct: 321 IDCNHKCPCMNGAECDRVSGVCSCSPGW 348 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +2 Query: 449 CENGGSCSTESTN----CICPPGYRDRTAR 526 C+NGG+C N C C PG+ T + Sbjct: 138 CQNGGTCKQSLQNGSFVCACAPGFHGNTCQ 167 >SB_6531| Best HMM Match : EGF_2 (HMM E-Value=0.0016) Length = 407 Score = 34.7 bits (76), Expect = 0.053 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +2 Query: 449 CENGGSCSTES--TNCICPPGYRDRTARRALHPT*CRHLR 562 C+NGG+C E+ + CICP GY + P C LR Sbjct: 106 CKNGGTCYVENHASKCICPKGYNGKECENG--PPDCETLR 143 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 34.3 bits (75), Expect = 0.070 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +2 Query: 449 CENGGSCST--ESTNCICPPGYRDRTAR 526 C+NGG+C ++ C+CP GY RT + Sbjct: 1034 CQNGGTCQDLDDTFECVCPEGYSGRTCQ 1061 Score = 31.9 bits (69), Expect = 0.38 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +2 Query: 299 RRRQGGFSGCIKDVVLNSNAVDINSSIKSSNIQECN---TYDRGDIQASESCQCENGGSC 469 +R + + CI V N A +N K+ I E T+ ++ S C++GG+C Sbjct: 852 KRCETKLNHCIGHVCANG-ATCMNGKDKAVCICESGFVGTHCDVNVNECNSMPCQHGGTC 910 Query: 470 STESTN--CICPPGYR 511 E N C+CP G R Sbjct: 911 IDEVNNFRCLCPTGTR 926 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGYRDRTARRALH 538 DI ES C N G+C S C CP G+ + L+ Sbjct: 819 DINECESDPCLNSGTCVDGVASFQCKCPVGFTGKRCETKLN 859 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 422 DIQASESCQCENGGSC---STESTNCICPPGY 508 D+ C+NGG+C + C C PGY Sbjct: 359 DLNYCRHLPCQNGGTCFNVGPDQHRCQCHPGY 390 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 34.3 bits (75), Expect = 0.070 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Frame = +2 Query: 317 FSGCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESC---QCENGGSCSTESTN 487 F+GC++D+ +NS + S+++SS+ T + + +C C NGG+C T Sbjct: 1427 FNGCVRDIFVNSVEQNFGSAVRSSS---SFTLPKPGCRKETNCHAESCANGGTCVATWTG 1483 Query: 488 CIC 496 C Sbjct: 1484 FQC 1486 Score = 31.9 bits (69), Expect = 0.38 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 12/80 (15%) Frame = +2 Query: 314 GFSGCIKDVVLN---SNAVDINSSIKSSNIQECNTYD-------RGDIQASESCQCENGG 463 GF+G + + +N SN + + ++ +C+ + + DI +S C N G Sbjct: 2006 GFTGALCETDINECASNPCNNGTCLQGIGRYDCSCFQGFTGQNCQVDINECQSFPCLNSG 2065 Query: 464 SCSTESTN--CICPPGYRDR 517 +C E N C CP GY R Sbjct: 2066 TCRDEVGNYSCRCPYGYEGR 2085 Score = 31.1 bits (67), Expect = 0.66 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +2 Query: 311 GGFSGCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGGSC--STEST 484 G F GCIKD LN + + I + + R D+ ++ +C NGG+C Sbjct: 1172 GNFVGCIKDFKLNLISDYLRDFIPHA-VHVTPGCARTDV--CKNHKCTNGGACVDMWSEY 1228 Query: 485 NCICPPGY 508 C CP G+ Sbjct: 1229 RCQCPTGF 1236 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGYRDR 517 DI ES C NGG+C +C C GY D+ Sbjct: 2674 DIDECESKPCVNGGTCIDRVAGYSCACAVGYTDQ 2707 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGY 508 +I S C NGGSC C C PGY Sbjct: 983 NIDECASSPCFNGGSCRDDVNGYTCTCAPGY 1013 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +2 Query: 440 SCQCENGGSC--STESTNCICPPGY 508 S C +GG+C E NC CP GY Sbjct: 1810 SSPCLHGGTCIDGFEDYNCTCPGGY 1834 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 449 CENGGSC--STESTNCICPPGYRDRT 520 C NG +C +C CP G+ D+T Sbjct: 2455 CRNGATCVDGINKYSCTCPAGFTDQT 2480 Score = 27.5 bits (58), Expect = 8.1 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 25 GFTSLTVRNGRLEFRYDLG-SGSTPVVLTSDRPLPANQWIDIQIARLADSVSMKIN 189 G L +RNGRL Y +G ST V + R L W ++I+ +++K+N Sbjct: 1333 GVLGLALRNGRLHAAYVMGFFQSTSVEI--GRDLSNGNWHRVEISVTFGYITIKVN 1386 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGYRDRTAR 526 +I S C N GSC S C C PGY R + Sbjct: 2636 NIDECASRPCANVGSCIDRINSYECTCVPGYTGRNCQ 2672 >SB_56964| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 908 Score = 33.9 bits (74), Expect = 0.093 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +2 Query: 449 CENGGSCSTEST---NCICPPGYRDRTARRA 532 C+NGGSCS + + NC C PG+ + A Sbjct: 198 CDNGGSCSVDGSGDYNCACRPGFTGKNCETA 228 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 33.9 bits (74), Expect = 0.093 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S C+NGG C+ + C CPPGY Sbjct: 1668 DIDECASSPCQNGGFCTDMINAFTCSCPPGY 1698 Score = 32.3 bits (70), Expect = 0.28 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCST--ESTNCICPPGY 508 +I S C+NGG C+ + C CPPGY Sbjct: 1630 NIDECASSPCQNGGLCTDMINAFTCTCPPGY 1660 Score = 31.1 bits (67), Expect = 0.66 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGY 508 +I S C+NGG+C+ + S C CP GY Sbjct: 880 EIDECSSNPCQNGGTCTDQLNSYLCTCPSGY 910 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGYRDR 517 ++ +S C+NGG+C S C C GY R Sbjct: 1478 EVNECQSDPCQNGGTCEDLIASYRCFCKAGYTGR 1511 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S C NGG+C+ ++ C C GY Sbjct: 1516 DIDECASSPCANGGTCTDLVDAHKCQCSTGY 1546 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 +I S C+NGG C+ + C C PGY Sbjct: 1706 NIDECASSPCQNGGFCTDMINAFTCTCLPGY 1736 >SB_32940| Best HMM Match : EGF (HMM E-Value=0) Length = 1025 Score = 33.9 bits (74), Expect = 0.093 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +2 Query: 449 CENGGSCSTESTN--CICPPGYR 511 C NGG CS TN C CP GYR Sbjct: 58 CTNGGLCSVNGTNFLCDCPQGYR 80 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCSTESTN--CICPPGYRDR 517 C NGG C E N C C GYR R Sbjct: 521 CYNGGFCVDEENNYRCDCGHGYRGR 545 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Frame = +2 Query: 368 NSSIKSSNIQECNTYDRGDIQASE----SCQCENGGSCSTESTN------CICPPGYRDR 517 N S+ S + C + RG+ E S C+NG +C + + C C PGY R Sbjct: 336 NFSMSSYQCKCCGGF-RGEFCEKEDHCFSKPCKNGATCKNKEGDPRHFYTCTCAPGYEGR 394 Query: 518 TARRAL 535 R + Sbjct: 395 DCSRVI 400 >SB_40116| Best HMM Match : EGF (HMM E-Value=0) Length = 340 Score = 33.5 bits (73), Expect = 0.12 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 4/27 (14%) Frame = +2 Query: 443 CQCENGGSCSTESTN----CICPPGYR 511 C CENGG+C S C+CP G++ Sbjct: 217 CTCENGGTCGVSSVYGHWFCVCPKGFK 243 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 33.5 bits (73), Expect = 0.12 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 4/27 (14%) Frame = +2 Query: 443 CQCENGGSCSTESTN----CICPPGYR 511 C CENGG+C S C+CP G++ Sbjct: 7261 CTCENGGTCGVSSVYGHWFCVCPKGFK 7287 Score = 30.7 bits (66), Expect = 0.87 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTEST--NCICPPGY 508 D+ +S C+NGGSC+ C C PG+ Sbjct: 6933 DVNECDSEPCQNGGSCTDMGNYYQCACVPGF 6963 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTN--CICPPGYRDRT 520 D+ +S C N +C E CIC PGY T Sbjct: 7085 DVNYCDSEPCMNNATCVDEQDGFTCICAPGYTGPT 7119 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 33.1 bits (72), Expect = 0.16 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 22 GGFTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIARLADSVSMKIN 189 G F SL + NG ++ R+DLGSG T +P+ N + + + R +S S+++N Sbjct: 1096 GDFISLALHNGFIQGRFDLGSGIGFGQTT--QPVTINTEVTVILNRTRNSGSLQLN 1149 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 350 SNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTN--CICPPGYR 511 S V+ S+I + + EC S++ C NGG+C+ + C C PG+R Sbjct: 951 SERVEAGSNIGNESYNEC---------ISQTPPCLNGGNCTRHAATYVCRCLPGWR 997 >SB_3456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Frame = +2 Query: 419 GDIQASESCQ---CENGGSCSTESTN---CICPPGYRDRTARR--ALHPT*CRH 556 GD A + C C+NGG+C+ E+ C C G+R HP+ CR+ Sbjct: 73 GDEDARKECDPDTCKNGGTCTEEAQGRHLCTCAVGFRGDNCEEPSKCHPSPCRN 126 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCS--TESTNCICPPGYRDR 517 C NGG CS E C+C G+R + Sbjct: 124 CRNGGECSETEEGYTCLCREGFRGK 148 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +2 Query: 440 SCQCENGGSCSTEST--NCICPPGY 508 + +C NGGSC +T C CP GY Sbjct: 195 AARCVNGGSCHDTATGFKCKCPFGY 219 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +2 Query: 413 DRGDIQASESCQCENGGSCSTESTN--CICPPGYRDRT 520 D D+ + C+N G+C ++ + C CP YR +T Sbjct: 149 DCEDLNQCDPNPCKNSGTCFEQNGDFVCNCPKMYRGKT 186 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 395 QECNTYDRGDIQASESCQCENGGSCSTESTN--CICPPGYRDRT 520 Q C T DI + C NGG+C E N C CP GY +T Sbjct: 546 QRCET----DIDECLTTPCLNGGTCHDEINNFRCDCPTGYYGKT 585 Score = 31.1 bits (67), Expect = 0.66 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTEST--NCICPPGYRDRTARRALHPT*C 550 +I E C NGGSC+ T C C PGY + T C Sbjct: 466 EIDLCEPEPCANGGSCTNFYTYYTCTCVPGYTGKQCAAGYTGTNC 510 >SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 32.7 bits (71), Expect = 0.22 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = +2 Query: 428 QASESC---QCENGGSCST--ESTNCICPPGYRDRTARR 529 + SE C C NGGSC + C CPPG++ + R Sbjct: 483 RTSEVCLPDPCHNGGSCYIVDDKFKCFCPPGFKGDSCER 521 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/58 (25%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = +2 Query: 389 NIQECNTYDRGDIQASESCQCENGGSCSTES----TNCICPPGYRDRTARRALHPT*C 550 + Q Y + E C + G C C+C PGY + +RAL C Sbjct: 344 SFQTMQEYQGLQVYGCEPNPCLHDGKCHRTHHRTRIRCVCMPGYTGQRCQRALKKARC 401 >SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2641 Score = 32.7 bits (71), Expect = 0.22 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 425 IQASESCQCENGGSCSTESTNCICPPGY 508 I A+ SC CENGG C C CP G+ Sbjct: 2333 INAAASCNCENGGKC--VDGVCQCPAGH 2358 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 32.3 bits (70), Expect = 0.28 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +2 Query: 404 NTYDRGDIQASESCQ---CENGGSCSTESTNCIC 496 N + I+A SC C+NGG+CST ++ IC Sbjct: 1035 NAFQDSVIEALNSCYINPCKNGGTCSTSASKLIC 1068 Score = 32.3 bits (70), Expect = 0.28 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 425 IQASESCQCENGGSCS-TE-STNCICPPGYRDRTARRA 532 + +S C NGG CS TE +C+CP G+ +T ++ Sbjct: 1895 LSTCDSSPCLNGGFCSNTEIGFSCVCPVGFAGKTCEKS 1932 >SB_39056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 32.3 bits (70), Expect = 0.28 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +2 Query: 389 NIQECNTYDRGDIQASESCQCENGGSCSTE----STNCICPPGY 508 N + + +D D A S C NGG+CS S +C C PG+ Sbjct: 105 NKTDSDYFDNRDDLACASFPCANGGTCSDSCDLGSFHCTCAPGF 148 >SB_34555| Best HMM Match : EGF (HMM E-Value=7.00649e-45) Length = 979 Score = 32.3 bits (70), Expect = 0.28 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +2 Query: 425 IQASESCQCENGGSCSTESTN----CICPPGYRDRTARRALHP 541 +Q +S C+NGGSC+ + N C CP Y + P Sbjct: 210 VQRCDSSPCKNGGSCTNKPDNTGYTCTCPSEYTGTECETQVQP 252 Score = 31.9 bits (69), Expect = 0.38 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 398 ECNTYDRGDIQASESCQCENGGSCSTESTN----CICPPGY 508 EC T +Q +S C+NGG+C+ ++ N C C GY Sbjct: 325 ECET----QVQPCDSSPCKNGGACANKADNSGFTCACASGY 361 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 398 ECNTYDRGDIQASESCQCENGGSCSTESTN----CICPPGY 508 EC T +Q +S C+NGG+C+ ++ N C C GY Sbjct: 245 ECET----QVQPCDSSPCKNGGACANKADNSGYTCDCASGY 281 >SB_54457| Best HMM Match : EGF (HMM E-Value=4.6e-31) Length = 200 Score = 31.9 bits (69), Expect = 0.38 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Frame = +2 Query: 383 SSNIQECNTYDRGDIQASESCQCENGGSCSTEST-----NCICPPGYRDRTAR 526 + N N R + A +S C NGG+CS + CICP G+ +T + Sbjct: 59 NDNYGGINCEARLNNNACQSSPCLNGGTCSVDPVKESEYTCICPNGFSGQTCQ 111 >SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1408 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCST--ESTNCICPPGYRDR 517 C+NG +C+ + NC C PGY DR Sbjct: 679 CDNGATCNNFNGTYNCTCVPGYTDR 703 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCST--ESTNCICPPGYRDR 517 C+NG +C+ + NC C PGY DR Sbjct: 799 CDNGATCNNFNGTYNCTCVPGYTDR 823 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S CENG +C+ NC C PGY Sbjct: 708 DINECASNPCENGATCNDLINYFNCTCVPGY 738 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S CENG +C+ NC C PGY Sbjct: 828 DINECASNPCENGATCNDLINYFNCTCVPGY 858 Score = 30.7 bits (66), Expect = 0.87 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +2 Query: 446 QCENGGSC--STESTNCICPPGY 508 +CENG +C CICPPG+ Sbjct: 640 RCENGATCVDKVNRKECICPPGW 662 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +2 Query: 449 CENGGSCS-TESTN---CICPPGYRDRTARRALHP 541 C+NGG C T N C CP GY LHP Sbjct: 485 CQNGGVCKETFDRNIYTCACPQGYTGWNCNGTLHP 519 >SB_50568| Best HMM Match : EGF (HMM E-Value=0) Length = 792 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCST--ESTNCICPPGYRDR 517 C+NG +C+ + NC C PGY DR Sbjct: 8 CDNGATCNNFNGTYNCTCVPGYTDR 32 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCST--ESTNCICPPGYRDR 517 C+NG +C+ + NC C PGY DR Sbjct: 128 CDNGATCNNFNGTYNCTCVPGYTDR 152 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S CENG +C+ NC C PGY Sbjct: 37 DINECASNPCENGATCNDLINYFNCTCVPGY 67 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI S CENG +C+ NC C PGY Sbjct: 157 DINECASNPCENGATCNDLINYFNCTCVPGY 187 >SB_34553| Best HMM Match : F5_F8_type_C (HMM E-Value=8.3e-22) Length = 667 Score = 31.9 bits (69), Expect = 0.38 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = +2 Query: 398 ECNTYDRGDIQASESCQCENGGSCSTESTN----CICPPGYRDRTARRALHP 541 EC T +Q +S C+NGG+C+ ++ N C C Y HP Sbjct: 250 ECET----QVQPCDSSPCKNGGACANKADNSGYTCACASAYTGIECESQAHP 297 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 31.9 bits (69), Expect = 0.38 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +2 Query: 443 CQCENGGSC--STESTNCICPPGYRDR 517 C C+NGG C + CIC PG+ + Sbjct: 130 CPCKNGGHCVNKVDGFTCICSPGFNGK 156 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 31.9 bits (69), Expect = 0.38 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +2 Query: 443 CQCENGGSC--STESTNCICPPGYRDR 517 C C+NGG C + CIC PG+ + Sbjct: 130 CPCKNGGHCVNKVDGFTCICSPGFNGK 156 >SB_3977| Best HMM Match : EGF (HMM E-Value=1.8e-09) Length = 108 Score = 31.9 bits (69), Expect = 0.38 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTN--CICPPGYR 511 DI + C NGG+C N C CP GYR Sbjct: 18 DIDKCHAMPCMNGGTCIATLNNYRCQCPEGYR 49 >SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 683 Score = 31.5 bits (68), Expect = 0.50 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +2 Query: 317 FSGCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTE--STNC 490 F+GCIKDV + N + + E RG A S C+NGG C + S+ C Sbjct: 175 FTGCIKDVEIQIG----NGVQEELRLVESKGRVRGCRNACRSNPCQNGGRCINKIWSSAC 230 Query: 491 IC 496 C Sbjct: 231 DC 232 >SB_5993| Best HMM Match : EGF_2 (HMM E-Value=9e-14) Length = 360 Score = 31.5 bits (68), Expect = 0.50 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 443 CQCENGGSCSTESTNCICPPG 505 C+C NG SC S C C PG Sbjct: 203 CKCVNGESCDPVSGECYCKPG 223 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 425 IQASESCQCENGGSCSTESTNCICPPG-YRDRTARR 529 + C C NGG+C S C C G Y D+ R Sbjct: 154 VNCEHKCACLNGGTCDRVSGCCECNSGWYGDKCQYR 189 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 31.5 bits (68), Expect = 0.50 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGY 508 DI +S C++G +C S CIC PGY Sbjct: 329 DIDECQSNPCQHGSACMDGVSSYQCICQPGY 359 Score = 30.7 bits (66), Expect = 0.87 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +2 Query: 419 GDIQASESCQCENGGSC-STEST--NCICPPGY 508 G+ ++ C NGGSC S ST C CP GY Sbjct: 517 GNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGY 549 Score = 30.7 bits (66), Expect = 0.87 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSC--STESTNCICPPGY 508 DI S C NGG C T C+C PGY Sbjct: 671 DIDECSSSPCVNGGLCVDYTNYFECLCHPGY 701 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 D+ S C NGG C+ CICP G+ Sbjct: 215 DVNECSSSPCVNGGVCADGLGEYKCICPSGF 245 >SB_825| Best HMM Match : EGF (HMM E-Value=5.6e-08) Length = 316 Score = 31.5 bits (68), Expect = 0.50 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 4/24 (16%) Frame = +2 Query: 449 CENGGSC----STESTNCICPPGY 508 C+NGGSC +T S +C+C PG+ Sbjct: 8 CKNGGSCRTIYNTNSYHCVCTPGW 31 >SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 802 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 431 ASESCQCENGGSCSTESTN--CICPPGYR 511 AS QCE G +C N C+CP GYR Sbjct: 668 ASGIHQCEEGATCVNTPGNYSCLCPQGYR 696 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 31.1 bits (67), Expect = 0.66 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +2 Query: 449 CENGGSCSTESTN---CICPPGY 508 C+NGG+C++ S++ C C PGY Sbjct: 3885 CQNGGTCASPSSSNYTCTCAPGY 3907 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = +2 Query: 371 SSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTNCICP-----PGYRDRTARRAL 535 S +K + ++ C D+ S C+NGGSC+ ++ IC G R A Sbjct: 3043 SFVKRTKLEICQVADQ-----CSSYPCKNGGSCANSGSSYICTCTSEFTGKNCEIVRDAC 3097 Query: 536 HPT*C 550 +PT C Sbjct: 3098 NPTPC 3102 >SB_22952| Best HMM Match : EGF_2 (HMM E-Value=2e-23) Length = 300 Score = 31.1 bits (67), Expect = 0.66 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 413 DRGDIQASESCQCENGGSCSTESTNCICPPGY 508 D G + + C C G+C+ + C+C G+ Sbjct: 179 DSGGVDCRQHCNCTEWGTCNPFTGKCLCQSGF 210 Score = 27.5 bits (58), Expect = 8.1 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 416 RGDIQASESCQCENGGSCSTESTNCICPPGY 508 R + +C C+N +CS + C C G+ Sbjct: 137 RWGVGCQGTCDCKNNATCSPFTGQCNCTSGF 167 >SB_21594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCST--ESTNCICPPGY 508 DI +S C+NGG+C+ +C C PG+ Sbjct: 507 DINECQSNPCKNGGTCANGEHKYSCACAPGF 537 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.1 bits (67), Expect = 0.66 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +2 Query: 326 CIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGG---SCSTESTNCIC 496 CIK +LNS + ++ + + +Y G I S +C C N G SC S C C Sbjct: 519 CIKSKLLNSPSGPSHAFWRPFKSNKLQSYWGGAIPGSGACACGNKGTPSSCDNPSKLCNC 578 >SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3112 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +2 Query: 386 SNIQECNT--YDRGDIQASESCQCENGGSCSTESTNCICPP 502 SN+ +CN D G + SE CE C ++S NC P Sbjct: 440 SNVSQCNVPKSDLGFLCGSEDHYCEKESECVSKSVNCTVFP 480 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 31.1 bits (67), Expect = 0.66 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCST--ESTNCICPPGYRDR 517 DI S C+NGG C + + C CP G+ R Sbjct: 432 DIDNCASSPCQNGGRCESLKDDFRCACPGGFTGR 465 Score = 30.7 bits (66), Expect = 0.87 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 440 SCQCENGGSCST--ESTNCICPPGYRDRTARRA 532 S C NGG+C C+CP GY R A Sbjct: 1110 SNSCTNGGTCVDLPNEFKCVCPSGYEGRRCEHA 1142 >SB_58558| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +2 Query: 449 CENGGSCSTESTN---CICPPGY 508 C NGG+C T+ N C CPPGY Sbjct: 436 CGNGGTC-TDQLNAYLCTCPPGY 457 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI C+NGG+C+ +C C PGY Sbjct: 312 DINECAVNSCQNGGNCTDLVNGFSCTCAPGY 342 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGY 508 DI S C+NGGSC+ + C C GY Sbjct: 465 DINECASFPCQNGGSCTDQVNGYTCSCAAGY 495 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +2 Query: 437 ESCQCENGGSC--STESTNCICPPGY 508 +S C NGGSC ++ C CP GY Sbjct: 508 QSMPCLNGGSCKDKVDAYECTCPLGY 533 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCS--TESTNCICPPGY 508 DI + C NGGSC+ C C PGY Sbjct: 541 DINDCQPNPCLNGGSCTDRVNGYTCACAPGY 571 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTES--TNCICPPGY 508 D+ S C NGG+C+ E+ C C GY Sbjct: 655 DVDECSSNPCVNGGTCNDEAGGYTCTCAAGY 685 >SB_22957| Best HMM Match : EGF (HMM E-Value=7e-39) Length = 201 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 449 CENGGSCST----ESTNCICPPGYRDRTARRALHP 541 C+NGG C + C CP GY LHP Sbjct: 38 CQNGGVCKETFDRNNYTCACPQGYTGWNCNGTLHP 72 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Frame = +2 Query: 419 GDIQASESCQCENGGSCSTESTN-----CICPPGY 508 G + E+ C NGG+C +S C+C G+ Sbjct: 68 GTLHPCETLNCNNGGTCQKQSNASDDYVCVCVTGF 102 >SB_15072| Best HMM Match : EGF (HMM E-Value=5.8e-08) Length = 234 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +2 Query: 449 CENGGSCS--TESTNCICPPGY 508 CENGG C T+ CICP G+ Sbjct: 128 CENGGICLAITDGPRCICPIGF 149 >SB_9507| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2735 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/78 (25%), Positives = 31/78 (39%), Gaps = 3/78 (3%) Frame = +2 Query: 317 FSGCIKDVVLNSNAVDINSSIKSSNIQE-CNTYDRGDIQASESCQCENGGSC--STESTN 487 F+GCI++++ D+ S + +N +E C T D Q C +C S Sbjct: 1867 FNGCIRNLINEGRLYDLKSPSRQNNTREGCATMD----QHCNPNSCHEQATCIGSLNGHV 1922 Query: 488 CICPPGYRDRTARRALHP 541 C C G T + P Sbjct: 1923 CECNMGRHGDTCKHTTQP 1940 >SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) Length = 240 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +2 Query: 401 CNTYDRGDI-QASESC---QCENGGSCSTESTN--CICPPGYRDRTARRALHPT 544 C + RG++ ++C C+NG +C++ + C C P YR + R H T Sbjct: 103 CPSGYRGEVCDVIDNCLSNPCQNGATCNSVAGGFTCTCTPEYRGNSVTRKRHVT 156 >SB_42888| Best HMM Match : EGF (HMM E-Value=8.4e-20) Length = 167 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +2 Query: 419 GDIQASESCQCENGGSCSTESTN---CICPPGY 508 GD+ E+ C+NGG+C C C PGY Sbjct: 46 GDLFCKEARPCKNGGTCVDTGPKLYACRCAPGY 78 >SB_20264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 371 SSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTN--CICPPGY 508 S I N C T +I S C+NGG+C+ N C+C PG+ Sbjct: 240 SCIPGFNGTNCET----NIDECASGPCQNGGTCNDGVNNYTCLCIPGF 283 >SB_16748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 437 ESCQCENGGSCSTEST--NCICPPGYRDR 517 +S C+N G+C E C C PG+ D+ Sbjct: 171 QSSPCKNSGTCKDEDNGYTCACVPGFTDK 199 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTN---CICPPGYRDRT 520 DI C NGG+C T+ N C CP GY T Sbjct: 204 DINECAGDPCANGGTC-TDGINGFTCTCPAGYNGST 238 >SB_3578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +2 Query: 449 CENGGSCSTESTN--CICPPGYRDR 517 C NG +CS+ C CPPGY R Sbjct: 326 CRNGATCSSNEGQYKCKCPPGYGGR 350 >SB_2152| Best HMM Match : EGF (HMM E-Value=0) Length = 1603 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 449 CENGGSCST----ESTNCICPPGYRDRTARRALHP 541 C+NGG C + C CP GY LHP Sbjct: 62 CQNGGVCKETFDRNNYTCACPQGYTGWNCNGTLHP 96 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTNCI 493 DI ES C N G+C E C+ Sbjct: 442 DINECESNPCRNNGTCRNEERGCV 465 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Frame = +2 Query: 419 GDIQASESCQCENGGSCSTESTN-----CICPPGY 508 G + E+ C NGG+C +S C+C G+ Sbjct: 92 GTLHPCETLNCNNGGTCQKQSNASDDYVCVCVTGF 126 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 6/35 (17%) Frame = +2 Query: 434 SESCQ---CENGGSCSTESTN---CICPPGYRDRT 520 S+SC C++G SC+ + C CP GY +T Sbjct: 366 SDSCHPNPCKHGASCAIVNETDFTCACPTGYTGKT 400 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 449 CENGGSCSTESTNCICPPGY 508 C+NGG+CS+ +T C CP Y Sbjct: 346 CQNGGTCSSPNT-CKCPFAY 364 >SB_36893| Best HMM Match : Fibrinogen_C (HMM E-Value=2.4e-24) Length = 411 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 404 NTYDRGDIQASESCQCENGGSCSTEST----NCICPPGYRDRTARRAL 535 NT D S C+NGGSC+ +S C C GY + L Sbjct: 139 NTRDTRITMPCASNPCKNGGSCTDKSDGLNYTCACRMGYEGEICEKVL 186 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 28 FTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIAR 159 F +L + L F Y+LG P V+ SDR + +W + + R Sbjct: 3865 FIALEIVERYLWFSYNLGYTGIPEVIKSDRAVTDGKWHHVTVIR 3908 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 449 CENGGSCSTESTN--CICPPGYRDRTARRAL 535 C+NGG+C + C CP G+ R +A+ Sbjct: 3984 CDNGGTCVDTWLDYYCECPDGFSGRNCEKAM 4014 >SB_9474| Best HMM Match : EGF (HMM E-Value=2e-08) Length = 237 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +2 Query: 437 ESCQCENGGSC---STESTNCICPPGY 508 +S C+NGG C S +C+CP GY Sbjct: 3 QSNPCQNGGDCLETGDGSYSCMCPTGY 29 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +2 Query: 449 CENGGSCST--ESTNCICPPGYRDRTARRALH 538 C NGG C++ +S C C GY T LH Sbjct: 581 CLNGGHCTSAGDSYKCACNEGYSGTTCEVTLH 612 >SB_52863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 29.1 bits (62), Expect = 2.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 449 CENGGSCSTESTNCICPPGY 508 C GSC++ S C C PGY Sbjct: 368 CSGHGSCNSASGLCTCAPGY 387 >SB_48559| Best HMM Match : Peptidase_A17 (HMM E-Value=2e-38) Length = 1541 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +1 Query: 97 VVLTSDRPLPANQWIDIQIARLADSVSMKINLVRSFERRLDRPAESSRFETP 252 VVL +D LP NQW +A ++ K NLVR + + + FE P Sbjct: 1304 VVLMTDPDLPRNQW---PLAIISKVFPSKDNLVRKVQVTTAKDGQHKCFERP 1352 >SB_39963| Best HMM Match : EGF (HMM E-Value=1.4e-13) Length = 3035 Score = 29.1 bits (62), Expect = 2.6 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +2 Query: 449 CENGGSCSTESTN--CICPPG 505 C+NGG C + C+CPPG Sbjct: 165 CKNGGQCVNKDDGYLCLCPPG 185 >SB_38959| Best HMM Match : EGF (HMM E-Value=0.14) Length = 177 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 9/46 (19%) Frame = +2 Query: 398 ECNTYDRGDIQA-SESCQCENGGSC--------STESTNCICPPGY 508 ECN D I ++ C C+NGG+C + C CP G+ Sbjct: 112 ECNANDTTAITLMAQFCPCQNGGTCYPHPYYPRGSGQYECACPKGF 157 >SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) Length = 439 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +2 Query: 398 ECNTYDRGDIQASESCQCEN----GGSCSTESTNCICPPGYRDRT 520 EC Y G + C N GG+CS C C PGY T Sbjct: 27 ECEKYWSGADCGTYIGTCNNCSSVGGTCSAGPDTCACRPGYTGPT 71 >SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) Length = 519 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +2 Query: 371 SSIKSSNIQECNTYDRGDIQASESCQCENGGSCSTESTNCICPPGY 508 S K N+QEC A C NGGSC + +T C C GY Sbjct: 475 SEEKPCNLQEC--------PAQCGLPCLNGGSCVSRNT-CACKKGY 511 >SB_58992| Best HMM Match : VWA (HMM E-Value=2.4e-15) Length = 303 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +2 Query: 362 DINSSIKSSNIQECNTYDRGDIQASESCQCENGGSC--STESTNCICPPGY 508 D N ++ S + G S C NGGSC ++ S NC C Y Sbjct: 145 DKNINVLGSYVDRLRNGIGGVTNPCSSSPCLNGGSCVKTSNSYNCTCRAAY 195 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCST--ESTNCICPPGYRDRTARRAL 535 ++Q +S C++GG+C+ C C P Y +AL Sbjct: 1149 EVQECQSEPCQHGGTCTKRFNGYECSCAPTYTGANCEKAL 1188 >SB_24004| Best HMM Match : EGF (HMM E-Value=5.7e-14) Length = 808 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 9/46 (19%) Frame = +2 Query: 398 ECNTYDRGDIQA-SESCQCENGGSC--------STESTNCICPPGY 508 ECN D I ++ C C+NGG+C + C CP G+ Sbjct: 616 ECNANDTTAITLMAQFCPCQNGGTCYPHPYYPRGSGQYECACPKGF 661 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 125 SDWRRGPGNGATDCRKVG 142 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 197 SDWRRGPGNGATDCRKVG 214 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 81 SDWRRGPGNGATDCRKVG 98 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 82 SDWRRGPGNGATDCRKVG 99 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 144 SDWRRGPGNGATDCRKVG 161 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 144 SDWRRGPGNGATDCRKVG 161 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 79 SDWRRGPGNGAADCRKVG 96 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 82 SDWRRGPGNGATDCRKVG 99 >SB_45954| Best HMM Match : VWA (HMM E-Value=4e-26) Length = 715 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 440 SCQCENGGSCSTES--TNCICPPGY 508 S C+NGG+C+ S +C C PG+ Sbjct: 30 SAPCQNGGTCTVVSGGYSCACLPGF 54 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 72 SDWRRGPGNGATDCRKVG 89 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGAADCRKVG 62 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 71 SDWRRGPGNGAADCRKVG 88 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 78 SDWRRGPGNGATDCRKVG 95 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 58 SDWRRGPGNGATDCRKVG 75 >SB_24015| Best HMM Match : I-set (HMM E-Value=2.7e-21) Length = 609 Score = 28.7 bits (61), Expect = 3.5 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 437 ESCQCENGGSCSTESTNCICPPGY 508 + C+C GG C ++ C C G+ Sbjct: 302 DKCRCNRGGVCRAKTYRCECTTGF 325 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTESTNCICPPGYR 511 DI+ ES C+N G+C+ + PGYR Sbjct: 1890 DIKECESTPCQNNGTCTDSHSVSEFFPGYR 1919 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 6/35 (17%) Frame = +2 Query: 434 SESCQ---CENGGSCSTESTN---CICPPGYRDRT 520 S+SC C++G SC+ + C CP GY +T Sbjct: 579 SDSCHPNPCKHGASCNIVNETDFTCACPTGYTGKT 613 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 82 SDWRRGPGNGATDCRKVG 99 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_22511| Best HMM Match : EGF (HMM E-Value=0.053) Length = 120 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 9/56 (16%) Frame = +2 Query: 368 NSSIKSSNIQECNTYDRGDIQASE-SCQCENGGSC--------STESTNCICPPGY 508 N + K ECN D + C C++GG+C + C CP G+ Sbjct: 45 NKTFKFVATDECNASDTTTVTVKAMECPCQHGGTCHPHPYHPRGSGQYECACPAGF 100 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 82 SDWRRGPGNGAADCRKVG 99 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 79 SDWRRGPGNGAADCRKVG 96 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 236 SDWRRGPGNGATDCRKVG 253 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 144 SDWRRGPGNGATDCRKVG 161 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 72 SDWRRGPGNGATDCRKVG 89 >SB_8544| Best HMM Match : EGF (HMM E-Value=0.053) Length = 93 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 9/56 (16%) Frame = +2 Query: 368 NSSIKSSNIQECNTYDRGDIQASE-SCQCENGGSC--------STESTNCICPPGY 508 N + K ECN D + C C++GG+C + C CP G+ Sbjct: 6 NKTFKFVATDECNASDTTTVTVKAMECPCQHGGTCHPHPYHPRGSGQYECACPAGF 61 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 44 SDWRRGPGNGAADCRKVG 61 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 192 SDWRRGPGNGATDCRKVG 209 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +2 Query: 440 SCQCENGGSCSTES--TNCICPPGY 508 S C+NGG+C+ S +C C PG+ Sbjct: 23 SAPCQNGGTCTVVSGGYSCTCLPGF 47 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 58 SDWRRGPGNGATDCRKVG 75 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 81 SDWRRGPGNGAADCRKVG 98 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 192 SDWRRGPGNGAADCRKVG 209 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 144 SDWRRGPGNGATDCRKVG 161 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 58 SDWRRGPGNGATDCRKVG 75 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 449 CENGGSCSTES--TNCICPPGY 508 C+NGGSC E CIC GY Sbjct: 217 CQNGGSCLEEGGLGRCICQMGY 238 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Frame = +2 Query: 410 YDRGDIQASESCQ---CENGGSCSTESTNCICPPGYR--------DRTARRALHPT*CRH 556 Y+ D + + C C NGG+CS + +C G + D+ A+ +H T CR+ Sbjct: 343 YEGNDCERANPCSPNPCRNGGTCSEMNNAAVCACGVQFEGNQCEIDKCAKCDMHAT-CRN 401 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 437 ESCQCENGGSCST--ESTNCICPPGY 508 E C+NGG C+ C C PG+ Sbjct: 24 EPVPCQNGGQCTVVPNGYECTCSPGF 49 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 79 SDWRRGPGNGATDCRKVG 96 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 118 SDWRRGPGNGATDCRKVG 135 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 161 SDWRRGPGNGATDCRKVG 178 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGAADCRKVG 62 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 197 SDWRRGPGNGAADCRKVG 214 >SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 425 IQASESCQCENGGSCSTESTNCICPPGY 508 I+ +E C C + SC E C PPG+ Sbjct: 439 IEGNEQCDCGDENSCKAEG-GCCNPPGH 465 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 101 SDWRRGPGNGATDCRKVG 118 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 144 SDWRRGPGNGATDCRKVG 161 >SB_9022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 612 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 395 QECNTYDRGDIQASESCQCEN--GGSCSTESTNCICPP 502 +EC+ D+ + +E C C+ G SC C PP Sbjct: 210 KECSPLDKDGCKPNEKCLCDGQCGFSCVENGLQCPIPP 247 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.7 bits (61), Expect = 3.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 45 SDWRRGPGNGATDCRKVG 62 >SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGYRDRTARRA-LHPT*CRHLRR 565 D+ C+NGG C E +C C G+ + +A P CR ++ Sbjct: 316 DVNECSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQAPSKPLECRSYKK 366 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/38 (26%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGYRDRTARR 529 D+ + C+NGG C E +C+C G+ + + Sbjct: 1192 DVNECSTNPCQNGGVCKNEHGGYSCVCKAGFTGKNCEQ 1229 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 422 DIQASESCQCENGGSCSTE--STNCICPPGYRDRTARR 529 D+ C+NGG C E +C C G+ +T + Sbjct: 1040 DVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKTCEQ 1077 >SB_53139| Best HMM Match : EGF (HMM E-Value=3.2e-08) Length = 221 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/46 (28%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Frame = +2 Query: 398 ECNTYDRGDIQASE-SCQCENGGSC--------STESTNCICPPGY 508 ECN D + + C C++GG+C + C CP G+ Sbjct: 16 ECNASDTTTVSVKQMECPCQHGGTCHPHPYHPRGSGQYECACPAGF 61 >SB_44887| Best HMM Match : EGF (HMM E-Value=4.1e-09) Length = 193 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 425 IQASESCQCENGGSCST--ESTNCICPPGYRDRTARRAL 535 +Q +S C++GG+C+ C C P Y +AL Sbjct: 52 VQECQSEPCQHGGTCTKRFNGYECSCAPTYTGANCEKAL 90 >SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1041 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 84 RKHSRGAYK*QAIAREPMDRHSDRPPRGFRLHEDQLSTQLRETFG 218 +KH + + K R+ D+HS + R D+ S ++R+T G Sbjct: 155 KKHDKHSAKNTTNTRQKHDKHSAKNTTNTRQKHDKHSAKIRQTLG 199 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 28.3 bits (60), Expect = 4.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 195 SDWRRGPGNGGTDCRKVG 212 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 449 CENGGSC-STESTNCICPPGYRDRT 520 CENGG+C C+C PG+ T Sbjct: 3580 CENGGTCVDGTPPYCLCSPGWTGPT 3604 >SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +2 Query: 449 CENGGSCSTESTN--CICPPGY 508 C+NGG+C T+ + C C GY Sbjct: 278 CKNGGTCKTDGSTVACHCKEGY 299 >SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 1841 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 22 GGFTSLTVR-NGRLEFRYDLGSGSTPVVLTSDRPLPANQ 135 G F + + N ++ YD+G+G +V+ S PL N+ Sbjct: 1383 GDFIQVNITSNDTVQLSYDIGNGPEAIVVKSSSPLNTNR 1421 >SB_29802| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 546 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 347 NSNAVDINSSIKSSNIQECNTYDRGDIQASESCQCENGG--SCSTESTNCICPPGYRDRT 520 N+ + + + Q+C T G C C N G +C + CIC PGY R+ Sbjct: 62 NTGSCVCKDNFQGHRCQKCMTGYYG-FPLCIKCACSNSGFGTCG-QYGECICRPGYTGRS 119 >SB_54456| Best HMM Match : EGF (HMM E-Value=2.3e-31) Length = 491 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +2 Query: 437 ESCQCENGGSCST--ESTNCICPPGYR 511 E C NGG+CS C+C GY+ Sbjct: 354 EVSPCRNGGTCSAVGNEYRCVCALGYK 380 >SB_54230| Best HMM Match : EGF (HMM E-Value=0) Length = 1359 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 449 CENGGSC--STESTNCICPPGYRDRTARRA 532 C NG +C S C CPPG+ + +A Sbjct: 1067 CRNGATCINSMGDYRCSCPPGFTGQHCEKA 1096 >SB_51493| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00067) Length = 1873 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 565 PAEVATSGRMQCASRSTIPVAGWAYAVGGFSRTGT 461 PAEV T G Q + P A WA A+ G T T Sbjct: 879 PAEVVTPGDAQEVWATLYPEAPWAEAITGEKETTT 913 >SB_50229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 565 PAEVATSGRMQCASRSTIPVAGWAYAVGGFSRTGT 461 PAEV T G Q + P A WA A+ G T T Sbjct: 617 PAEVVTPGDAQEVWATLYPEAPWAEAITGEKETTT 651 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +2 Query: 449 CENGGSCSTEST---NCICPPGY 508 C+N G+C+ +ST CICP Y Sbjct: 1429 CKNQGACAMQSTGIRKCICPLSY 1451 >SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 28 FTSLTVRNGRLEFRYDLGSGSTPVVLTSDRPLPANQWIDIQIARL 162 F S+ + NG++ F+YD G+G V + W + + R+ Sbjct: 1324 FISVELVNGKIVFKYDTGAGLVRVESNFNYYSAGGVWYKVHLLRI 1368 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G + CR +G Sbjct: 133 SDWRRGPGNGATNCRKVG 150 >SB_19665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 380 KSSNIQECNTYDRGDIQASESCQCENGGSCSTESTNCICPPGY 508 K S+I EC GD ++ +C N + S C C PGY Sbjct: 159 KCSDIDECAV--SGDSPCDKNAECNN----TVGSYTCTCKPGY 195 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 184 SSWRRNPRGGRSECRSIG 131 S WRR P G ++CR +G Sbjct: 123 SYWRRGPGNGATDCRKVG 140 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 27.5 bits (58), Expect = 8.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 449 CENGGSCSTESTNCICPPGY 508 C G+C + + CIC PG+ Sbjct: 1432 CSGHGTCDSANHKCICDPGW 1451 >SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) Length = 3083 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 434 SESCQCENGGSCSTESTNCICPPG 505 ++ CQ N C +S + ICPPG Sbjct: 308 TKPCQGLNNTVCQNQSMDLICPPG 331 >SB_47132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +2 Query: 419 GDIQASESCQCE--NGGSC--STESTNCICPPGYRDRTARRALHP 541 G +Q + C G+C S CICPPGY R + P Sbjct: 19 GSVQGTGLCASNPCTLGACMESPSGYYCICPPGYSGAGCRTQISP 63 >SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2324 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 311 GGFSGCIKDVVLNSNAVDINSSIKSSNIQECNTYDRGDIQA 433 G G +KD V S+A D+ S S++QE + + A Sbjct: 1424 GAEGGAVKDDVTTSSAGDVGSESSMSDVQEFGRFFHKQLSA 1464 >SB_2059| Best HMM Match : PAN (HMM E-Value=0.024) Length = 297 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 2/19 (10%) Frame = +2 Query: 449 CENGGSCS-TESTN-CICP 499 C+NGG+CS T S N C+CP Sbjct: 82 CKNGGTCSNTCSENLCVCP 100 >SB_703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +2 Query: 431 ASESCQCENGGSC--STESTNCICPPGY 508 AS S C G C +++T C+CP GY Sbjct: 5 ASVSGSCGTAGVCVAKSDATACLCPIGY 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,084,025 Number of Sequences: 59808 Number of extensions: 372436 Number of successful extensions: 1686 Number of sequences better than 10.0: 171 Number of HSP's better than 10.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1655 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -