BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30129 (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.9 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 6.5 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 449 CENGGSCSTESTNCICPPGYR 511 C+ G S C C PGY+ Sbjct: 234 CKGDGKWYLPSGGCHCKPGYQ 254 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 274 SSTPPTKSESRTGSFQP 224 S PP SES TGS P Sbjct: 352 SPEPPKSSESSTGSSIP 368 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/54 (20%), Positives = 21/54 (38%) Frame = -2 Query: 313 ALTPALGFTTTVESSTPPTKSESRTGSFQPVYPNVSRSCVLS*SSWRRNPRGGR 152 A+T G + ++ P ++ +P P CV +W + + GR Sbjct: 3 AITNPKGKKRYITAAFPSACGKTNLAMMKPTLPGYKIECVGDDIAWMKFDKEGR 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,338 Number of Sequences: 438 Number of extensions: 3490 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -