BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30127 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 25 0.55 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 3.9 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 5.1 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 9.0 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 9.0 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.0 bits (52), Expect = 0.55 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -3 Query: 229 PNHFSTFRRRGFTMRMSTAKCLKFLL 152 PN ++ F + +T + KC+K+L+ Sbjct: 33 PNFYNDFEVQRYTWKCENQKCVKYLV 58 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 546 LDCSRLLDESSRAETSSKELP 484 LDCS+ E E SKE P Sbjct: 64 LDCSKNSPEKESEEKKSKEKP 84 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 5.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 537 SRLLDESSRAETSSKELPSMISSSFCF 457 S + S R S K+LPS S S CF Sbjct: 155 SYIKPSSERDYFSVKKLPSPASDSECF 181 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 502 CLCSAALIQQSTTVKNKDIRKFLDGLY 582 C + AL+ K+ I++FL G+Y Sbjct: 99 CRSALALLLSPEVGKDHRIKRFLRGVY 125 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 9.0 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = +3 Query: 210 KVEKWFGSKKELAAVGQSVHM*RT*LKE*LKASNTRCVLCMLTSPLTVS 356 +V+ WF +++ Q H + +++ K N + TSP VS Sbjct: 112 RVQVWFKNRRAKCRQQQKQHNQQQSVEKSSKLKNKSAPILTKTSPTPVS 160 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,526 Number of Sequences: 336 Number of extensions: 3339 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -