BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30125 (477 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.47 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.47 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 1.4 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 4.4 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 4.4 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 4.4 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.47 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 82 WNLVPVVVKLLYLASC 129 WNL+P+ V +L A+C Sbjct: 922 WNLLPIAVFILVCATC 937 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.47 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 82 WNLVPVVVKLLYLASC 129 WNL+P+ V +L A+C Sbjct: 922 WNLLPIAVFILVCATC 937 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 80 DETENTIASTTYSETSDKL 24 DET+N + TY+E +KL Sbjct: 340 DETKNHYSKNTYNEQGNKL 358 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 80 DETENTIASTTYSETSDKL 24 DET+N + TY+E +KL Sbjct: 232 DETKNHYSKNTYNEQGNKL 250 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.0 bits (47), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +2 Query: 278 DQQGKNGPKKPQP--DHILVTEP 340 D Q +N PK+P+P D VT P Sbjct: 322 DHQRRNEPKRPRPNIDRHEVTRP 344 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 4.4 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -1 Query: 114 QQLHNH--GHQIP**NGEHHSKHDVQRDL 34 Q ++NH GH + + +HH H Q+ + Sbjct: 160 QSMNNHHMGHHMQEQHPQHHQPHHQQQHM 188 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 4.4 Identities = 16/61 (26%), Positives = 24/61 (39%) Frame = +3 Query: 51 RACYGVLRFIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVNTATRHVL 230 R C+ V +E RG V + + K + LMI CN YV+ ++ Sbjct: 205 RLCFQVF---LEGERRGKFTVPLTPVVSEPIYDKKAMSDLMIVKLSHCNSYVDGGRNEII 261 Query: 231 L 233 L Sbjct: 262 L 262 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 4.4 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -1 Query: 114 QQLHNH--GHQIP**NGEHHSKHDVQRDL 34 Q ++NH GH + + +HH H Q+ + Sbjct: 162 QSMNNHHMGHHMQEQHPQHHQPHHQQQHM 190 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,255 Number of Sequences: 336 Number of extensions: 2241 Number of successful extensions: 17 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -