BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30119 (363 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 30 0.49 SB_45933| Best HMM Match : RVT_1 (HMM E-Value=3.2e-13) 27 6.0 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 30.3 bits (65), Expect = 0.49 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 104 ASGFMG*RYRPSCCTRCSSCFWSTPCSRRMVCAGTR*VEHNCXXTSR-RHRTPSWGG 271 A GF G R C +RC ++ T CS C T + C TS H P W G Sbjct: 437 APGFTGDR----CESRCPKGYYGTNCSNACTCKATN--TNVCDVTSGFCHCNPGWSG 487 >SB_45933| Best HMM Match : RVT_1 (HMM E-Value=3.2e-13) Length = 901 Score = 26.6 bits (56), Expect = 6.0 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -1 Query: 225 LCSTHL-VPAQTILLEQGVLQKQELQRVQQEGRYLQPMKPLAPVFHSSLHGQE 70 L + HL P+ + L L++QEL+ + GR + + P+A F H E Sbjct: 558 LSAKHLGYPSSRLFLTGKTLRQQELEPARLMGRRCKTLLPVAGSFLQPQHSTE 610 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,112,410 Number of Sequences: 59808 Number of extensions: 119549 Number of successful extensions: 3389 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3387 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -