BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30114 (716 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 25 0.61 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 25 0.61 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 24 1.1 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 3.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 5.7 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 25.0 bits (52), Expect = 0.61 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 326 KDKSVWFLDHDYLENMYGMFKKVNAREKVVG 418 K KS + HD L N+Y K V A K++G Sbjct: 6 KVKSYFTTHHDTLHNIYTSMKPVYAICKLIG 36 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 25.0 bits (52), Expect = 0.61 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 326 KDKSVWFLDHDYLENMYGMFKKVNAREKVVG 418 K KS + HD L N+Y K V A K++G Sbjct: 6 KVKSYFTTHHDTLHNIYTSMKPVYAICKLIG 36 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -3 Query: 651 SHFFSLLCTNFTWNMFK--GPRSWCTIIVYFLYCLVSF 544 S F L+ N + F+ +S+CT + +YC V+F Sbjct: 20 SEIFCLVNFNHRESYFRLSKAKSFCTFVAALVYCSVTF 57 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 633 LCTNFTWNMFKGPRSWCTIIVYFLYCLVSF 544 +C NF + + + Y LYC SF Sbjct: 525 ICKNFCFGFITKQLIFMIFVTYQLYCWSSF 554 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +2 Query: 275 GVLDVSNSFAVPFDEDDKDKSV 340 G L+ ++ + P D+DDKD+ + Sbjct: 225 GSLEDDDNISDPEDDDDKDQDM 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,033 Number of Sequences: 336 Number of extensions: 3260 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -