BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30114 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-tran... 26 1.3 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.1 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 24 4.1 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 23 9.5 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 9.5 >AY070234-1|AAL58538.1| 223|Anopheles gambiae glutathione S-transferase E3 protein. Length = 223 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +2 Query: 338 VWFLDHDYLENMYGMFKKVNAREKVVGWYHTGPKLHQNDIAINELIRRYCPNSVL 502 V ++D ENM + K+N V G L+ + IN L+++Y + L Sbjct: 31 VQYIDLAKKENMTEEYLKMNPMHTVPTVNDNGVPLYDSHAIINYLVQKYAKDDTL 85 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 533 VYRLKLTKQ*RKYTMMVHQLRGPLNMFQVKLVQRRLKK 646 V++L Q KY + + ++GPLN + Q+ K+ Sbjct: 970 VFKLHYKVQNNKYVLKLKSMKGPLNNSLTEQKQKSYKQ 1007 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +2 Query: 410 VVGWYHTGPKLHQNDIAINELIRRYCPNSVLV 505 ++ W GP+ H+ + I + Y P +L+ Sbjct: 316 IINWNFRGPRTHRMPMWIRSVFLHYLPAMLLM 347 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 278 RLWLSNNP*NTDYSFLIPDFTHAVKMVHDT 189 RLWL+NN + IP F KM D+ Sbjct: 280 RLWLTNNAPASKLIVSIPTFGRGWKMNGDS 309 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.0 bits (47), Expect = 9.5 Identities = 15/63 (23%), Positives = 33/63 (52%) Frame = +2 Query: 461 INELIRRYCPNSVLVILMLNLKILVYRLKLTKQ*RKYTMMVHQLRGPLNMFQVKLVQRRL 640 +N ++R SVL ++ ++++ L K+ K + M+ + LN+ Q+K++Q Sbjct: 271 LNLIVRDAIKKSVLPVVEEVKRVVM----LFKKSPKASQMLADTQKKLNLDQLKMIQEVS 326 Query: 641 KKW 649 +W Sbjct: 327 TRW 329 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,984 Number of Sequences: 2352 Number of extensions: 13414 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -