BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30113 (770 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 5e-41 SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_27355| Best HMM Match : ABC_tran (HMM E-Value=1.1e-37) 37 0.021 SB_38838| Best HMM Match : ABC_tran (HMM E-Value=0.24) 36 0.036 SB_36627| Best HMM Match : ABC_tran (HMM E-Value=5.4e-06) 36 0.048 SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) 33 0.19 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 33 0.19 SB_26155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44672| Best HMM Match : ABC_tran (HMM E-Value=4.2039e-44) 32 0.45 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 32 0.45 SB_37511| Best HMM Match : ABC_tran (HMM E-Value=0) 32 0.59 SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_39746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_14067| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_58724| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_12613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_46572| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 31 1.4 SB_2226| Best HMM Match : RVT_1 (HMM E-Value=4.6e-09) 31 1.4 SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) 30 1.8 SB_49133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40840| Best HMM Match : ABC-3 (HMM E-Value=2.4) 30 2.4 SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) 30 2.4 SB_52472| Best HMM Match : ABC_tran (HMM E-Value=4.62428e-44) 30 2.4 SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) 29 3.1 SB_10268| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58705| Best HMM Match : ABC_tran (HMM E-Value=5.7e-05) 29 4.2 SB_26620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_24754| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) 29 4.2 SB_53189| Best HMM Match : ABC_tran (HMM E-Value=0.021) 29 5.5 SB_37300| Best HMM Match : MMR_HSR1 (HMM E-Value=0.061) 29 5.5 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) 28 7.3 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 28 7.3 SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14) 28 7.3 SB_7019| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) 28 7.3 >SB_35286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 165 bits (400), Expect = 5e-41 Identities = 74/84 (88%), Positives = 77/84 (91%) Frame = +2 Query: 257 CVKKCPFDAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTAL 436 C KKCPF+AITIIN+PSNLEK TTHRY NSFKLHRLPIPRPGEVLGLVG NGIGKSTAL Sbjct: 69 CAKKCPFEAITIINLPSNLEKDTTHRYGPNSFKLHRLPIPRPGEVLGLVGTNGIGKSTAL 128 Query: 437 KILAGKQKPNLGRYTDPPDWQEIL 508 KILAGKQKPNLGR+ PPDWQEIL Sbjct: 129 KILAGKQKPNLGRHDTPPDWQEIL 152 Score = 117 bits (281), Expect = 1e-26 Identities = 52/74 (70%), Positives = 58/74 (78%) Frame = +3 Query: 54 MSRRKDHEETDKLTRIAIVNADRCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIATISE 233 M+ R D +KLTRIAIV+ D+CKPKRCRQECKKSCPVVRMGKLCIEVTP K+A ISE Sbjct: 1 MAFRADQSTQEKLTRIAIVSTDKCKPKRCRQECKKSCPVVRMGKLCIEVTPETKLAAISE 60 Query: 234 ELCIGCGFV*RNVP 275 LCIGCG + P Sbjct: 61 PLCIGCGICAKKCP 74 Score = 102 bits (245), Expect = 3e-22 Identities = 53/84 (63%), Positives = 62/84 (73%) Frame = +1 Query: 511 HFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGTVGQLLDKKDEMKNQSVICRMLD 690 HFRGSELQNYFTKILEDDLKA+IKPQYVDQIPKAVK + G L ++V D Sbjct: 154 HFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAVKVSEGMLYSISRVTTIRAVAG---D 210 Query: 691 LSHIRDREIAALSGGELQRFACAM 762 L+ + +R + LSGGELQRFACA+ Sbjct: 211 LTAVMERNVDELSGGELQRFACAV 234 Score = 33.9 bits (74), Expect = 0.15 Identities = 12/27 (44%), Positives = 22/27 (81%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQKPN 466 E++ ++G+NG GK+T +++LAGK P+ Sbjct: 346 EIIVMLGENGTGKTTFIRMLAGKLSPD 372 >SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 958 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 RPGE+L L+G +G GK+T L +LAG+ + G Sbjct: 33 RPGEMLALMGPSGSGKTTLLNVLAGRMAKDAG 64 >SB_27355| Best HMM Match : ABC_tran (HMM E-Value=1.1e-37) Length = 226 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQKPNLG 472 E++GLVG+NG GK+T L+ L G+ P G Sbjct: 2 EIIGLVGENGNGKTTLLRSLCGELNPTSG 30 >SB_38838| Best HMM Match : ABC_tran (HMM E-Value=0.24) Length = 169 Score = 35.9 bits (79), Expect = 0.036 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 3/92 (3%) Frame = +2 Query: 326 THRYSKNSFKLHRLPIPR--PGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYTDPPDWQ 499 T RY ++ L+ R PGE +GLVG +G GK+T +K++ N GR D Q Sbjct: 72 TFRYGRHEAPLYDRFSARIAPGERVGLVGHSGSGKTTFIKLIQRLYDVNGGRIA--IDGQ 129 Query: 500 EILLI-SGALSCKITSQRSSKMI*RRSLSLNM 592 +I + +L +I + ++ R+L+ N+ Sbjct: 130 DIAQVRQASLRSQIAIVQQEPVLFHRTLAENI 161 >SB_36627| Best HMM Match : ABC_tran (HMM E-Value=5.4e-06) Length = 240 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 311 LEKHTTHRYSKNSFKLHRLPIP-RPGEVLGLVGQNGIGKSTALKILAG 451 L+ H+Y S L L + GEV L+G+NG+GK+T LK L G Sbjct: 84 LQVQQLHQYYGGSHILRGLSFDVKVGEVTCLLGRNGVGKTTLLKCLMG 131 >SB_30636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 PGEV+ L+G +G GKST L+ + ++PN G Sbjct: 46 PGEVVCLIGPSGSGKSTLLRCVNLLEQPNEG 76 >SB_7365| Best HMM Match : ABC_membrane (HMM E-Value=0) Length = 1301 Score = 33.5 bits (73), Expect = 0.19 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 4/63 (6%) Frame = +2 Query: 296 NIPSNLEKHTTHRY--SKNSFK-LHRLPIP-RPGEVLGLVGQNGIGKSTALKILAGKQKP 463 N+ ++ + H Y S+N K L+ L + R G+ + LVG++G GKST +K++ P Sbjct: 647 NVTGDVTFNDIHFYYPSRNEVKVLNGLSLTVRSGQTVALVGESGCGKSTVIKLIQRFYDP 706 Query: 464 NLG 472 G Sbjct: 707 ENG 709 >SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) Length = 562 Score = 33.5 bits (73), Expect = 0.19 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKIL 445 PGEV GL+G NG GK+T L ++ Sbjct: 318 PGEVFGLLGPNGAGKTTTLNMM 339 >SB_26155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 815 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAG 451 + GE++G++G +G GKST + +LAG Sbjct: 150 KSGELVGVLGPSGAGKSTLINVLAG 174 >SB_44672| Best HMM Match : ABC_tran (HMM E-Value=4.2039e-44) Length = 945 Score = 32.3 bits (70), Expect = 0.45 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G+++ +G NG GK+T + IL G P G Sbjct: 528 GQIMSFLGHNGAGKTTTMSILTGLFPPTAG 557 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 32.3 bits (70), Expect = 0.45 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G++ L+G NG GK+T + IL G P G Sbjct: 227 GQITALLGHNGAGKTTTMSILTGLFTPTSG 256 >SB_37511| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 884 Score = 31.9 bits (69), Expect = 0.59 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G++ L+G NG GKST + L G +P+ G Sbjct: 522 GQITALLGHNGAGKSTLIGALTGMIQPSSG 551 >SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 31.9 bits (69), Expect = 0.59 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 392 LGLVGQNGIGKSTALKILAGKQKPNLG 472 + +VG NG GK+T LKIL G+ +P G Sbjct: 367 IAVVGDNGSGKTTLLKILLGELEPVKG 393 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQ 457 G GLVG+NGIGK+T L+ L+ ++ Sbjct: 232 GRRYGLVGRNGIGKTTLLRTLSKRE 256 >SB_39746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 31.5 bits (68), Expect = 0.78 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 PG+V+ LVG +G GKST + +L +P G Sbjct: 379 PGQVVALVGPSGGGKSTCINLLEHLYEPTGG 409 >SB_14067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.78 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 392 LGLVGQNGIGKSTALKILAGKQKPNLG 472 + LVG NG GKST LK++ G P G Sbjct: 89 VALVGPNGAGKSTLLKLIEGLLSPTEG 115 >SB_58724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 31.1 bits (67), Expect = 1.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GEV ++G +G GK+T L L+GK Sbjct: 162 RAGEVTAIMGPSGAGKTTLLNTLSGK 187 >SB_12613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 651 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILA 448 +PG +L ++G +G GKST + +LA Sbjct: 218 KPGSLLAIMGASGAGKSTLMNVLA 241 >SB_46572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 51 EMSRRKDHE-ETDKLTRIAIVNADRCKPKRCRQECKKSCPVVRM 179 EM + K H E + RI +V+++ P+ CR EC ++ M Sbjct: 372 EMQKEKSHLLEVPDVGRINLVSSNSSSPRSCRSECSTPAELLAM 415 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G++ L+G NG GK+T + +L G P G Sbjct: 335 GQITALLGHNGAGKTTLMSMLTGLFPPTSG 364 >SB_2226| Best HMM Match : RVT_1 (HMM E-Value=4.6e-09) Length = 944 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 445 CWQAEAQL-GSLH*PSRLARDTSHFRGSELQNYFTKILEDDLKALIKPQY 591 C+ +E Q+ GS H S + D+S SEL TK+L+ L+ P Y Sbjct: 764 CYASEIQINGSSHSGSAASGDSSPSAASELATVVTKLLQSSLQPSSMPIY 813 >SB_52342| Best HMM Match : ABC_tran (HMM E-Value=5.29999e-41) Length = 336 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKIL 445 PG+ L LVG +G GKST +++L Sbjct: 167 PGQTLALVGNSGGGKSTIIRLL 188 >SB_49133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1331 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = -2 Query: 277 KGTFLHTKPQPIHSSSEMVAILSLGVTSMQSFPIRTTGQLFLHSCLHLFGLQRSAFTIA 101 +G+ H K P + +++ ++LG Q ++ F +CLH F QRSA +A Sbjct: 1254 RGSLQHAKSDPGKLAETVLSDVALG----QKQGDASSASKFARNCLHFFAKQRSAIPVA 1308 >SB_40840| Best HMM Match : ABC-3 (HMM E-Value=2.4) Length = 235 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 260 VKKCPFDAITIINIPSNLEKHTTHRYSKNSFKLH-RLPIPRPGEVLGLVGQNGIGKSTAL 436 V C ++++ + NL+ T + L L +P G ++ +VGQ G GKST L Sbjct: 160 VPTCSLIDLSLVALSINLDVPTCSLIDLSLVALSINLDVPA-GSLVAVVGQVGCGKSTLL 218 Query: 437 KILAGK 454 L G+ Sbjct: 219 SALLGE 224 >SB_22546| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 844 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKIL 445 R G+ + LVG++G GKST +K++ Sbjct: 143 RSGQTVALVGESGCGKSTLIKLV 165 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G+ L LVG +G GKST + +L P G Sbjct: 695 GQTLALVGPSGCGKSTTVSLLERFYDPEDG 724 >SB_52472| Best HMM Match : ABC_tran (HMM E-Value=4.62428e-44) Length = 322 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYTDPP 490 +PG L + G NG GKS+ +IL+G G PP Sbjct: 91 QPGMHLLITGPNGCGKSSLFRILSGLWPVYKGYLAKPP 128 >SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +2 Query: 356 LHRLPIPRP-GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 LH + + P G ++ +VGQ G GKST L L G+ + G Sbjct: 564 LHNINLNIPDGSLVAVVGQVGCGKSTLLSALLGETEKVTG 603 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKST 430 +PGE +G+VG+ G GKST Sbjct: 1357 QPGEKIGIVGRTGAGKST 1374 >SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 L IP G ++ +VGQ G GKST L L G+ + G+ Sbjct: 298 LNIPE-GSLVAVVGQVGCGKSTLLSALLGETEKTKGQ 333 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKST 430 +PGE +G+VG+ G GKS+ Sbjct: 926 QPGEKIGIVGRTGAGKSS 943 >SB_34187| Best HMM Match : ABC_tran (HMM E-Value=1.49995e-41) Length = 1515 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKIL 445 RPGE +G+VG+ G GKS+ L Sbjct: 1360 RPGERVGIVGKTGAGKSSVFAAL 1382 >SB_10268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 PGE + LVG +G GKST + ++ P G Sbjct: 185 PGETVALVGPSGGGKSTVISLIERFYDPMTG 215 >SB_58935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 320 HTTHRYSKNSFKLHRLP-IPRPGEVLGLVGQNGIGKSTAL 436 + T R+ N L L + RP V+G +G +GKST L Sbjct: 36 YATERFITNDDALKELSKLSRPVRVIGAIGDARVGKSTTL 75 >SB_58705| Best HMM Match : ABC_tran (HMM E-Value=5.7e-05) Length = 284 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILA 448 PG +L ++G +G GKST + +LA Sbjct: 142 PGTLLAVMGASGAGKSTLMNVLA 164 >SB_26620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 433 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 + GEV ++G +G GK+T L L+GK Sbjct: 339 KSGEVTAVMGPSGAGKTTFLNTLSGK 364 >SB_24754| Best HMM Match : ABC_tran (HMM E-Value=1.3e-36) Length = 781 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 + GEV ++G +G GK+T L L+GK Sbjct: 221 KSGEVTAVMGPSGAGKTTFLNTLSGK 246 >SB_53189| Best HMM Match : ABC_tran (HMM E-Value=0.021) Length = 127 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGK 454 GEV ++G +G GK+T L L+GK Sbjct: 17 GEVTAVMGPSGAGKTTFLNTLSGK 40 >SB_37300| Best HMM Match : MMR_HSR1 (HMM E-Value=0.061) Length = 152 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILA 448 PGE++ ++G +G GK+T + +LA Sbjct: 47 PGELVAVMGASGSGKTTLINVLA 69 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 28.3 bits (60), Expect = 7.3 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +3 Query: 9 ECRQYFASVRLLLTEMSRRKDHEETDKLTRIAIVNADRCKPKRCRQECKKS 161 E +YFA R+L+T R + H K+T + + P RCR EC S Sbjct: 320 EKHRYFALKRVLVT--GRCECHGHAQKVT---FIKGNSSSPGRCRCECDPS 365 >SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 618 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 356 LHRLP-IPRPGEVLGLVGQNGIGKSTALKILAGKQKP 463 LH + + +P E +G+VG+ G GKS+ L L +P Sbjct: 52 LHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLFRLAEP 88 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKP 463 +P E +G+VG+ G GKS+ L L +P Sbjct: 900 KPAEKVGIVGRTGAGKSSLLATLFRMAEP 928 >SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14) Length = 441 Score = 28.3 bits (60), Expect = 7.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKP 463 G GL+G NG GKST L + ++ P Sbjct: 81 GRKYGLIGLNGCGKSTMLTAIGKREIP 107 >SB_7019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 433 CSRLSYTVLANKT*NFSWSWDRQ 365 C RLS T A+ + N SW W R+ Sbjct: 280 CRRLSSTPFASASSNHSWGWQRK 302 >SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) Length = 474 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKIL 445 GE +G+VG+NG GKS+ + L Sbjct: 93 GEKIGIVGRNGSGKSSVIHAL 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,769,960 Number of Sequences: 59808 Number of extensions: 566636 Number of successful extensions: 1684 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1683 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -