BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30113 (770 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19210.1 68417.m02834 RNase L inhibitor protein, putative sim... 157 6e-39 At3g13640.1 68416.m01718 RNase L inhibitor protein, putative sim... 152 3e-37 At5g64840.1 68418.m08157 ABC transporter family protein 40 0.002 At5g09930.1 68418.m01148 ABC transporter family protein 40 0.002 At1g65410.1 68414.m07421 ABC transporter family protein contains... 39 0.003 At5g52860.1 68418.m06561 ABC transporter family protein 38 0.007 At3g13220.1 68416.m01654 ABC transporter family protein contains... 38 0.010 At2g13610.1 68415.m01500 ABC transporter family protein 37 0.017 At4g25750.1 68417.m03707 ABC transporter family protein Bactroce... 36 0.022 At5g06530.2 68418.m00737 ABC transporter family protein 36 0.030 At5g06530.1 68418.m00736 ABC transporter family protein 36 0.030 At1g64550.1 68414.m07317 ABC transporter family protein similar ... 36 0.039 At1g63270.1 68414.m07153 ABC transporter family protein 36 0.039 At4g33460.1 68417.m04753 ABC transporter family protein ABC-type... 35 0.052 At3g54540.1 68416.m06035 ABC transporter family protein similar ... 35 0.052 At3g47750.1 68416.m05202 ABC transporter family protein probable... 35 0.068 At3g52310.1 68416.m05749 ABC transporter family protein contains... 34 0.090 At4g25450.1 68417.m03665 ABC transporter family protein similar ... 34 0.12 At3g47740.1 68416.m05201 ABC transporter family protein ATP bind... 34 0.12 At4g27420.1 68417.m03941 ABC transporter family protein D.melano... 33 0.16 At4g18050.1 68417.m02686 ABC transporter family protein contains... 33 0.16 At5g44110.1 68418.m05397 ABC transporter family protein 33 0.21 At3g47760.1 68416.m05203 ABC transporter family protein probable... 33 0.21 At3g25620.1 68416.m03189 ABC transporter family protein similar ... 33 0.21 At1g03905.1 68414.m00375 ABC transporter family protein similar ... 33 0.21 At5g60790.1 68418.m07627 ABC transporter family protein similar ... 33 0.28 At3g47790.1 68416.m05206 ABC transporter family protein contains... 33 0.28 At3g47770.1 68416.m05204 ABC transporter family protein AbcA, Di... 33 0.28 At2g36380.1 68415.m04464 ABC transporter family protein related ... 33 0.28 At2g26910.1 68415.m03228 ABC transporter family protein similar ... 33 0.28 At2g01320.4 68415.m00049 ABC transporter family protein 33 0.28 At2g01320.3 68415.m00047 ABC transporter family protein 33 0.28 At2g01320.2 68415.m00046 ABC transporter family protein 33 0.28 At2g01320.1 68415.m00048 ABC transporter family protein 33 0.28 At1g70610.1 68414.m08135 ABC transporter (TAP1) contains Pfam pr... 33 0.28 At5g61740.1 68418.m07747 ABC transporter family protein ABC fami... 32 0.36 At5g61700.1 68418.m07741 ABC transporter family protein ABC fami... 32 0.36 At4g01830.1 68417.m00240 multidrug resistance P-glycoprotein, pu... 32 0.36 At4g01820.1 68417.m00239 multidrug resistance P-glycoprotein, pu... 32 0.36 At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transport... 32 0.36 At3g47780.1 68416.m05205 ABC transporter family protein transpor... 32 0.36 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 32 0.36 At2g41700.1 68415.m05151 ABC transporter family protein similar ... 32 0.36 At2g29940.1 68415.m03642 ABC transporter family protein similar ... 32 0.36 At1g66950.1 68414.m07612 ABC transporter family protein similar ... 32 0.36 At1g02530.1 68414.m00204 multidrug resistance P-glycoprotein, pu... 32 0.36 At5g02270.1 68418.m00150 ABC transporter family protein NBD-like... 32 0.48 At3g55110.1 68416.m06120 ABC transporter family protein ATP-bind... 32 0.48 At3g53480.1 68416.m05904 ABC transporter family protein PDR5-lik... 32 0.48 At3g21090.1 68416.m02666 ABC transporter family protein similar ... 32 0.48 At2g37280.1 68415.m04573 ABC transporter family protein similar ... 32 0.48 At1g51500.1 68414.m05796 ABC transporter family protein similar ... 32 0.48 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 32 0.48 At1g02520.1 68414.m00203 multidrug resistance P-glycoprotein, pu... 32 0.48 At3g16340.1 68416.m02066 ABC transporter family protein similar ... 31 0.64 At2g47000.1 68415.m05871 multidrug resistant (MDR) ABC transport... 31 0.64 At1g59870.1 68414.m06745 ABC transporter family protein similar ... 31 0.64 At1g53270.1 68414.m06037 ABC transporter family protein contains... 31 0.64 At1g15520.1 68414.m01867 ABC transporter family protein similar ... 31 0.64 At1g15210.1 68414.m01818 ABC transporter family protein Similar ... 31 0.64 At5g19410.1 68418.m02313 ABC transporter family protein white me... 31 0.84 At3g55100.1 68416.m06119 ABC transporter family protein ATP-bind... 31 0.84 At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PG... 31 0.84 At5g03910.1 68418.m00371 ABC transporter family protein ABC-type... 31 1.1 At1g71960.1 68414.m08318 ABC transporter family protein similar ... 31 1.1 At1g51460.1 68414.m05792 ABC transporter family protein similar ... 31 1.1 At5g14100.1 68418.m01649 ABC transporter family protein contains... 30 1.5 At4g25960.1 68417.m03735 multidrug resistance P-glycoprotein, pu... 30 1.5 At4g15230.1 68417.m02333 ABC transporter family protein similar ... 30 1.5 At3g10670.1 68416.m01283 ABC transporter family protein similar ... 30 1.5 At2g37010.1 68415.m04539 ABC transporter family protein contains... 30 1.5 At1g31770.1 68414.m03899 ABC transporter family protein contains... 30 1.5 At5g46540.1 68418.m05730 ABC transporter family protein contains... 30 1.9 At4g30300.1 68417.m04306 ABC transporter family protein ribonucl... 30 1.9 At4g15236.1 68417.m02335 ABC transporter family protein similar ... 30 1.9 At4g15233.1 68417.m02334 ABC transporter family protein similar ... 30 1.9 At4g15215.1 68417.m02332 ABC transporter family protein similar ... 30 1.9 At1g53390.1 68414.m06052 ABC transporter family protein similar ... 30 1.9 At5g13580.1 68418.m01570 ABC transporter family protein 29 2.6 At3g55130.1 68416.m06122 ABC transporter family protein breast c... 29 2.6 At3g55090.1 68416.m06118 ABC transporter family protein ATP-bind... 29 2.6 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 2.6 At5g01670.2 68418.m00084 aldose reductase, putative similar to a... 29 3.4 At5g01670.1 68418.m00083 aldose reductase, putative similar to a... 29 3.4 At5g57960.1 68418.m07252 GTP-binding family protein similar to S... 29 4.5 At2g39350.1 68415.m04830 ABC transporter family protein 29 4.5 At2g33520.1 68415.m04109 expressed protein 29 4.5 At1g17840.1 68414.m02208 ABC transporter family protein similar ... 29 4.5 At5g60740.1 68418.m07621 ABC transporter family protein similar ... 28 5.9 At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, pu... 28 5.9 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 28 5.9 At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR... 28 5.9 At5g43500.1 68418.m05319 expressed protein 28 7.9 At3g53510.1 68416.m05908 ABC transporter family protein breast c... 28 7.9 At3g13090.1 68416.m01639 ABC transporter, putative similar to MR... 28 7.9 At2g37360.1 68415.m04582 ABC transporter family protein 28 7.9 At2g28070.1 68415.m03408 ABC transporter family protein 28 7.9 At1g27940.1 68414.m03423 multidrug resistance P-glycoprotein, pu... 28 7.9 At1g07620.1 68414.m00817 GTP1/OBG family protein similar to SP|P... 28 7.9 >At4g19210.1 68417.m02834 RNase L inhibitor protein, putative similar to 68 kDa protein HP68 GI:16755057 from [Triticum aestivum] Length = 605 Score = 157 bits (382), Expect = 6e-39 Identities = 69/84 (82%), Positives = 76/84 (90%) Frame = +2 Query: 257 CVKKCPFDAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTAL 436 CVKKCPF+AI IIN+P +LEK TTHRY N+FKLHRLP+PRPG+VLGLVG NGIGKSTAL Sbjct: 61 CVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL 120 Query: 437 KILAGKQKPNLGRYTDPPDWQEIL 508 KILAGK KPNLGR+T PPDWQEIL Sbjct: 121 KILAGKLKPNLGRFTSPPDWQEIL 144 Score = 124 bits (300), Expect = 5e-29 Identities = 56/87 (64%), Positives = 73/87 (83%) Frame = +1 Query: 508 SHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGTVGQLLDKKDEMKNQSVICRML 687 +HFRGSELQNYFT+ILED+LKA+IKPQYVD IP+AVKG VG++LD+KDE ++ +C L Sbjct: 145 THFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRAVKGNVGEVLDQKDERDKKAELCADL 204 Query: 688 DLSHIRDREIAALSGGELQRFACAMCA 768 +L+ + DR++ LSGGELQRFA A+ A Sbjct: 205 ELNQVIDRDVENLSGGELQRFAIAVVA 231 Score = 108 bits (259), Expect = 5e-24 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +3 Query: 84 DKLTRIAIVNADRCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIATISEELCIGCGFV* 263 D+LTRIAIV++DRCKPK+CRQECKKSCPVV+ GKLCIEVT K+A ISEELCIGCG Sbjct: 3 DRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCGICV 62 Query: 264 RNVP 275 + P Sbjct: 63 KKCP 66 Score = 34.7 bits (76), Expect = 0.068 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +1 Query: 580 KPQYVD-QIPKAVKGTVGQLL-DKKDEMKNQSVICRMLDLSHIRDREIAALSGGELQRFA 753 KPQ + + +V+ + Q + D + S + + L + + D+E+ LSGGELQR A Sbjct: 418 KPQKISPKFQNSVRHLLHQKIRDSYMHPQFMSDVMKPLQIEQLMDQEVVNLSGGELQRVA 477 Query: 754 CAMC 765 +C Sbjct: 478 LTLC 481 Score = 31.9 bits (69), Expect = 0.48 Identities = 11/27 (40%), Positives = 22/27 (81%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQKPN 466 +++ ++G+NG GK+T +++LAG KP+ Sbjct: 375 QIIVMLGENGTGKTTFIRMLAGLLKPD 401 >At3g13640.1 68416.m01718 RNase L inhibitor protein, putative similar to 68 kDa protein HP68 GI:16755057 from [Triticum aestivum] Length = 603 Score = 152 bits (368), Expect = 3e-37 Identities = 67/84 (79%), Positives = 73/84 (86%) Frame = +2 Query: 257 CVKKCPFDAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTAL 436 CVKKCPF+AI IIN+P +L K TTHRY N FKLHRLPIPRPG+VLGLVG NGIGKSTAL Sbjct: 61 CVKKCPFEAIQIINLPKDLAKDTTHRYGANGFKLHRLPIPRPGQVLGLVGTNGIGKSTAL 120 Query: 437 KILAGKQKPNLGRYTDPPDWQEIL 508 KILAGK KPNLGR+ PPDW+EIL Sbjct: 121 KILAGKLKPNLGRFNTPPDWEEIL 144 Score = 103 bits (248), Expect = 1e-22 Identities = 46/65 (70%), Positives = 52/65 (80%) Frame = +3 Query: 81 TDKLTRIAIVNADRCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIATISEELCIGCGFV 260 +D+LTRIAIV+ DRCKPK+CRQECKKSCPVV+ GKLCIEV K A ISEELCIGCG Sbjct: 2 SDRLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGKLCIEVGSTSKSAFISEELCIGCGIC 61 Query: 261 *RNVP 275 + P Sbjct: 62 VKKCP 66 Score = 96.3 bits (229), Expect = 2e-20 Identities = 45/98 (45%), Positives = 66/98 (67%) Frame = +1 Query: 466 LGSLH*PSRLARDTSHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGTVGQLLDK 645 LG + P +HFRGSELQ+YF +++E++LK IKPQ+VD I + V+G +G++L+K Sbjct: 131 LGRFNTPPDWEEILTHFRGSELQSYFIRVVEENLKTAIKPQHVDYIKEVVRGNLGKMLEK 190 Query: 646 KDEMKNQSVICRMLDLSHIRDREIAALSGGELQRFACA 759 DE IC ++L+ + +RE +SGGELQRFA A Sbjct: 191 LDERGLMEEICADMELNQVLEREARQVSGGELQRFAIA 228 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQKPNLGRYTDPPDW 496 +++ ++G+NG GK+T +++LAG G ++ P++ Sbjct: 375 QIIVMLGENGTGKTTFIRMLAGAFPREEGVQSEIPEF 411 >At5g64840.1 68418.m08157 ABC transporter family protein Length = 692 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 GE +GLVG NG GK+T L+I+ G+++P+ G Sbjct: 123 GEKVGLVGVNGAGKTTQLRIITGQEEPDSG 152 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = +2 Query: 341 KNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 K FK L I R GE + ++G NG GKST LK++ G +KP G Sbjct: 437 KMLFKKANLSIER-GEKIAILGPNGCGKSTLLKLIMGLEKPVKG 479 >At5g09930.1 68418.m01148 ABC transporter family protein Length = 678 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/32 (46%), Positives = 25/32 (78%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 + GE +GL+G NG GK+T L+I+ G+++P+ G Sbjct: 107 KKGEKVGLIGVNGAGKTTQLRIITGQEEPDSG 138 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 341 KNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 K F L I R GE + ++G NG GKST LK++ G +KP G Sbjct: 423 KMLFNKANLAIER-GEKVAIIGPNGCGKSTLLKLIMGLEKPMRG 465 >At1g65410.1 68414.m07421 ABC transporter family protein contains similarity to toluene tolerance protein Ttg2A GI:4336798 from [Pseudomonas putida] Length = 345 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 R GE +G++G +G GKST LKI+AG P+ G Sbjct: 108 RHGEAVGVIGPSGTGKSTILKIMAGLLAPDKG 139 >At5g52860.1 68418.m06561 ABC transporter family protein Length = 589 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 347 SFKLHRLPIP-RPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 SF L + + P E+L +VG +G GKST L ILA K P G Sbjct: 42 SFILRNITLTAHPTEILAVVGPSGAGKSTLLDILASKTSPTSG 84 >At3g13220.1 68416.m01654 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to white protein GB:Q27256 [Anopheles gambiae] Length = 685 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/35 (48%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNL-GRYT 481 PGE+L L+G +G GK+T LKI+ G+ N+ G+ T Sbjct: 116 PGEILALMGPSGSGKTTLLKIMGGRLTDNVKGKLT 150 >At2g13610.1 68415.m01500 ABC transporter family protein Length = 649 Score = 36.7 bits (81), Expect = 0.017 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGR-YTD--PPDWQEILLISGALSCKIT 541 +P E+L +VG +G GKS+ L+ILA + P G Y + P D ISG ++ K T Sbjct: 71 KPWEILAIVGPSGAGKSSLLEILAARLIPQTGSVYVNKRPVDRANFKKISGYVTQKDT 128 >At4g25750.1 68417.m03707 ABC transporter family protein Bactrocera tryoni membrane transporter (white) gene, PID:g3676298 Length = 577 Score = 36.3 bits (80), Expect = 0.022 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 347 SFKLHRLPIP-RPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 SF L + + P ++L ++G +G GKST L ILA + P G Sbjct: 28 SFILRNITLTSHPSQILAIIGPSGAGKSTLLDILAARTSPTSG 70 >At5g06530.2 68418.m00737 ABC transporter family protein Length = 691 Score = 35.9 bits (79), Expect = 0.030 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK 454 PGEVL L+G +G GK+T L +LAG+ Sbjct: 189 PGEVLALMGPSGSGKTTLLSLLAGR 213 >At5g06530.1 68418.m00736 ABC transporter family protein Length = 751 Score = 35.9 bits (79), Expect = 0.030 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK 454 PGEVL L+G +G GK+T L +LAG+ Sbjct: 189 PGEVLALMGPSGSGKTTLLSLLAGR 213 >At1g64550.1 68414.m07317 ABC transporter family protein similar to ABC transporter protein GB:AAF31030 GI:6899653 from [Leishmania major] Length = 715 Score = 35.5 bits (78), Expect = 0.039 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +2 Query: 392 LGLVGQNGIGKSTALKILAGKQKPNLG 472 + +VG NGIGKST LK+++G +P+ G Sbjct: 533 IAMVGPNGIGKSTILKLISGDLQPSSG 559 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILA 448 G GLVG+NG GK+T L+ +A Sbjct: 200 GRHYGLVGRNGTGKTTFLRYMA 221 >At1g63270.1 68414.m07153 ABC transporter family protein Length = 229 Score = 35.5 bits (78), Expect = 0.039 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G L L G NG GKST L++LAG KP+ G Sbjct: 36 GGALVLTGTNGSGKSTFLRMLAGFSKPSAG 65 >At4g33460.1 68417.m04753 ABC transporter family protein ABC-type transport protein sll1623 -Synechocystis,PIR2:S74812 Length = 271 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G++ ++G NG GKST LKILAG P+ G Sbjct: 70 GQLWMILGPNGCGKSTLLKILAGVVNPSSG 99 >At3g54540.1 68416.m06035 ABC transporter family protein similar to ABC50 GI:10863747 from [Rattus norvegicus] Length = 723 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKP 463 G+ GL+G NG+GKST LK+LA ++ P Sbjct: 188 GKRYGLIGPNGMGKSTLLKLLAWRKIP 214 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G + +VG NG GKST L +LAG P G Sbjct: 523 GTRVAIVGPNGAGKSTLLNLLAGDLVPTEG 552 >At3g47750.1 68416.m05202 ABC transporter family protein probable transport protein ABC-C, Homo sapiens, PIR2:S71363 Length = 944 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 PGE G++G NG GK++ + ++ G KP G Sbjct: 652 PGECFGMLGPNGAGKTSFINMMTGLVKPTSG 682 >At3g52310.1 68416.m05749 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter Length = 737 Score = 34.3 bits (75), Expect = 0.090 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK-QKPNLG---RYTDPP 490 PGE+L L+G +G GK+T L L G+ + N+G Y D P Sbjct: 177 PGELLALMGPSGSGKTTLLNALGGRFNQQNIGGSVSYNDKP 217 >At4g25450.1 68417.m03665 ABC transporter family protein similar to multidrug resistance protein 2 SP:P21440 from [Mus musculus] Length = 714 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 G V LVG +G GKST +++LA +P GR T Sbjct: 498 GTVTALVGSSGAGKSTIVQLLARFYEPTQGRIT 530 >At3g47740.1 68416.m05201 ABC transporter family protein ATP binding cassette transporter ABC1, Homo sapiens, PIR2:A54774 Length = 947 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +2 Query: 341 KNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 K + ++ L +P GE G++G NG GK++ + ++ G KP G Sbjct: 643 KKAVRVLSLAVPS-GECFGMLGPNGAGKTSFINMMTGLVKPTSG 685 >At4g27420.1 68417.m03941 ABC transporter family protein D.melanogaster P element CaSpeR-1 gene (white protein),PID:g870996 Length = 639 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 I +PGE+L ++G +G GK++ L L G+ G+ T Sbjct: 74 IVKPGEILAMLGPSGSGKTSLLTALGGRVGEGKGKLT 110 >At4g18050.1 68417.m02686 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1281 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 5/71 (7%) Frame = +2 Query: 278 DAITIINIPSNLE-KHTTHRYS-KNSFKLHR---LPIPRPGEVLGLVGQNGIGKSTALKI 442 + T+ N+ ++E +H + RY + ++ R L IP G+ + LVG++G GKST + + Sbjct: 982 EGTTLQNVNGDIEFRHVSFRYPMRPDVQIFRDLCLTIPS-GKTVALVGESGSGKSTVISM 1040 Query: 443 LAGKQKPNLGR 475 + P+ G+ Sbjct: 1041 IERFYNPDSGK 1051 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 G+ + LVGQ+G GKST + ++ P G+ Sbjct: 383 GKTVALVGQSGSGKSTVISLIERFYDPESGQ 413 >At5g44110.1 68418.m05397 ABC transporter family protein Length = 282 Score = 33.1 bits (72), Expect = 0.21 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGK 454 L +P L LVG NG GK+T LKILAGK Sbjct: 34 LDLPAGSRCL-LVGANGSGKTTLLKILAGK 62 >At3g47760.1 68416.m05203 ABC transporter family protein probable transport protein ABC-C, Homo sapiens, PIR2:S71363 Length = 872 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 L +P GE G++G NG GK++ + ++ G KP G Sbjct: 576 LAVPS-GECFGMLGPNGAGKTSFINMMTGLMKPTSG 610 >At3g25620.1 68416.m03189 ABC transporter family protein similar to GB:AAC61893 from [Bactrocera tryoni] (Insect Mol. Biol. 6 (4), 343-356 (1997)) Length = 467 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 I +PGE+L ++G +G GK+T + LAG+ + L Sbjct: 106 IVKPGELLAMLGPSGSGKTTLVTALAGRLQGKL 138 >At1g03905.1 68414.m00375 ABC transporter family protein similar to NBD-like protein GB:AAD20643 Length = 290 Score = 33.1 bits (72), Expect = 0.21 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGK 454 L +P L LVG NG GK+T LKILAGK Sbjct: 35 LDLPAGSRCL-LVGANGSGKTTLLKILAGK 63 >At5g60790.1 68418.m07627 ABC transporter family protein similar to ABC transporter homolog PnATH GI:7573600 from [Populus nigra] Length = 595 Score = 32.7 bits (71), Expect = 0.28 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 392 LGLVGQNGIGKSTALKILAGKQKPNLG 472 + LVG NG GKST LK++ G+ P G Sbjct: 409 VALVGPNGAGKSTLLKLMTGELHPTEG 435 >At3g47790.1 68416.m05206 ABC transporter family protein contains Pfam domain, PF00005: ABC transporter Length = 901 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/72 (26%), Positives = 35/72 (48%) Frame = +2 Query: 257 CVKKCPFDAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTAL 436 C+ K D+ + N + K + + L +P+ GE G++G NG GK++ + Sbjct: 576 CLLKSTRDSAVLCNNLKKVYSGKDGNPQKLAVRGLSLALPQ-GECFGMLGPNGAGKTSFI 634 Query: 437 KILAGKQKPNLG 472 ++ G KP+ G Sbjct: 635 NMMTGIIKPSSG 646 >At3g47770.1 68416.m05204 ABC transporter family protein AbcA, Dictyostelium discoideum, U66526 Length = 900 Score = 32.7 bits (71), Expect = 0.28 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 L +P GE G++G NG GK++ + ++ G KP+ G Sbjct: 610 LAVPS-GECFGMLGPNGAGKTSFINMMTGLVKPSSG 644 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 514 FRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGT 624 FRGS + FT I+ + + AL+ Y+D++ + K T Sbjct: 493 FRGSAMDEVFTIIIVEWVVALVATYYIDRVSSSSKDT 529 >At2g36380.1 68415.m04464 ABC transporter family protein related to multi drug resistance proteins and P-glycoproteins Length = 1453 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + LVG +G GK+T + +LAG++ Sbjct: 888 RPGVLTALVGVSGAGKTTLMDVLAGRK 914 >At2g26910.1 68415.m03228 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1420 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + LVG +G GK+T + +LAG++ Sbjct: 854 RPGVLTALVGVSGAGKTTLMDVLAGRK 880 >At2g01320.4 68415.m00049 ABC transporter family protein Length = 725 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 +PG +L ++G +G GK+T L +LAG+ Sbjct: 99 KPGRLLAIMGPSGSGKTTLLNVLAGQ 124 >At2g01320.3 68415.m00047 ABC transporter family protein Length = 728 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 +PG +L ++G +G GK+T L +LAG+ Sbjct: 99 KPGRLLAIMGPSGSGKTTLLNVLAGQ 124 >At2g01320.2 68415.m00046 ABC transporter family protein Length = 727 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 +PG +L ++G +G GK+T L +LAG+ Sbjct: 99 KPGRLLAIMGPSGSGKTTLLNVLAGQ 124 >At2g01320.1 68415.m00048 ABC transporter family protein Length = 725 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 +PG +L ++G +G GK+T L +LAG+ Sbjct: 99 KPGRLLAIMGPSGSGKTTLLNVLAGQ 124 >At1g70610.1 68414.m08135 ABC transporter (TAP1) contains Pfam profile: PF00005 ABC transporters; similar to TAP1 protein (transporter of processed antigen) GB:AAD53033 (Oncorhynchus mykiss); identical to cDNA transporter associated with antigen processing-like protein (TAP1) GI:19335721 Length = 700 Score = 32.7 bits (71), Expect = 0.28 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 PGEV+ +VG +G GKST + +L +P G+ Sbjct: 482 PGEVVAIVGLSGSGKSTLVNLLLQLYEPTSGQ 513 >At5g61740.1 68418.m07747 ABC transporter family protein ABC family transporter, Entamoeba histolytica, TREMBL:EH058 Length = 848 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 L +P GE G++G NG GK++ + ++ G KP G Sbjct: 552 LDVPS-GECFGMLGPNGAGKTSFINMMTGLLKPTSG 586 >At5g61700.1 68418.m07741 ABC transporter family protein ABC family transporter, Entamoeba histolytica, EMBL:EH058 Length = 888 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 GE G++G NG GK++ + ++ G KP+ G Sbjct: 597 GECFGMLGPNGAGKTSFISMMTGLLKPSSG 626 >At4g01830.1 68417.m00240 multidrug resistance P-glycoprotein, putative similar to multidrug resistant P-glycoprotein GI:4204793 from [Solanum tuberosum] Length = 1230 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 R G+ + LVG++G GKST + +L P+ G T Sbjct: 1011 RAGQTVALVGESGSGKSTVISLLQRFYDPDSGHIT 1045 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLGR-YTDPPDWQEILL 511 G LVG++G GKST + ++ PN G+ D D +E L Sbjct: 381 GTTTALVGESGSGKSTVISLIERFYDPNSGQVLIDGVDLKEFQL 424 >At4g01820.1 68417.m00239 multidrug resistance P-glycoprotein, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1229 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 R G+ + LVG++G GKST + +L P+ G T Sbjct: 1010 RAGQTVALVGESGSGKSTVISLLQRFYDPDSGHIT 1044 >At3g62150.1 68416.m06983 multidrug resistant (MDR) ABC transporter, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica]; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1292 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 R G+ + LVG++G GKST + +L P+ G+ T Sbjct: 1074 RAGKTIALVGESGSGKSTVIALLQRFYDPDSGQIT 1108 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G + LVGQ+G GKST + ++ P G Sbjct: 431 GSTVALVGQSGSGKSTVVSLIERFYDPQSG 460 >At3g47780.1 68416.m05205 ABC transporter family protein transport protein ABC-C, Homo sapiens, PIR2:S71363 Length = 935 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 L +P GE G++G NG GK++ + ++ G KP G Sbjct: 639 LAVPS-GECFGMLGPNGAGKTSFINMMTGLLKPTSG 673 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 I +PG + L+G G GKST LK L+GK + L Sbjct: 168 IIKPGRLTLLLGPPGSGKSTLLKALSGKTETGL 200 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T + +LAG++ Sbjct: 850 RPGVLTALMGVSGAGKTTLMDVLAGRK 876 >At2g41700.1 68415.m05151 ABC transporter family protein similar to ATP-binding cassette transporter ABCA1 GI:18031705 from [Arabidopsis thaliana] Length = 1822 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQKPNLG 472 ++L L+G NG GKST + +L G P G Sbjct: 513 QILSLLGHNGAGKSTTISMLVGLLPPTSG 541 >At2g29940.1 68415.m03642 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1426 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYTD 484 PG + LVG +G GK+T + +LAG++ G YT+ Sbjct: 863 PGVLTALVGSSGAGKTTLMDVLAGRK---TGGYTE 894 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 I +PG + L+G G GKST L LAGK +L Sbjct: 182 IIKPGRMTLLLGPPGSGKSTLLLALAGKLDKSL 214 >At1g66950.1 68414.m07612 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1454 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + LVG +G GK+T + +LAG++ Sbjct: 889 RPGILTALVGVSGAGKTTLMDVLAGRK 915 >At1g02530.1 68414.m00204 multidrug resistance P-glycoprotein, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1273 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 R G+ + LVG++G GKST + +L P+ G+ T Sbjct: 1053 RAGKTVALVGESGSGKSTVISLLQRFYDPDSGQIT 1087 >At5g02270.1 68418.m00150 ABC transporter family protein NBD-like protein POP, Arabidopsis thaliana, EMBL:AF127664 Length = 328 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +2 Query: 398 LVGQNGIGKSTALKILAGK 454 LVG NG GK+T LKIL GK Sbjct: 53 LVGSNGAGKTTILKILGGK 71 >At3g55110.1 68416.m06120 ABC transporter family protein ATP-binding cassette-sub-family G-member 2, Mus musculus, EMBL:AF140218 Length = 708 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GE+L ++G +G GKST + LAG+ Sbjct: 100 RDGEILAVLGGSGAGKSTLIDALAGR 125 >At3g53480.1 68416.m05904 ABC transporter family protein PDR5-like ABC transporter, Spirodela polyrrhiza, EMBL:Z70524 Length = 1450 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T L +LAG++ Sbjct: 886 RPGILTALMGVSGAGKTTLLDVLAGRK 912 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 I +PG + L+G GK+T LK L+G + NL Sbjct: 196 IIKPGRLTLLLGPPSCGKTTLLKALSGNLENNL 228 >At3g21090.1 68416.m02666 ABC transporter family protein similar to ATP-binding cassette, sub-family G (WHITE), member 2 GB:NP_036050 from [Mus musculus] Length = 691 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 PG ++ ++G +G GKST L LAG+ N+ Sbjct: 55 PGRIMAIMGPSGSGKSTLLDSLAGRLARNV 84 >At2g37280.1 68415.m04573 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1413 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T L +LAG++ Sbjct: 849 RPGVLTALMGISGAGKTTLLDVLAGRK 875 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLGRY 478 PG + L+G G GK+T LK L+G + NL Y Sbjct: 164 PGRLTLLLGPPGCGKTTLLKALSGNLENNLKCY 196 >At1g51500.1 68414.m05796 ABC transporter family protein similar to GB:AAF61569 from [Bombyx mori] Length = 687 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 PG ++ ++G +G GKST L LAG+ N+ Sbjct: 54 PGRIMAIMGPSGSGKSTLLDSLAGRLARNV 83 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 31.9 bits (69), Expect = 0.48 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 332 RYSKN-SFKLHRLPIPRPG-EVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 RY++N LH + PG + +G+VG+ G GKST ++ L +P G+ T Sbjct: 1276 RYAENLPTVLHGVSCVFPGGKKIGIVGRTGSGKSTLIQALFRLIEPTAGKIT 1327 >At1g02520.1 68414.m00203 multidrug resistance P-glycoprotein, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1278 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 R G+ + LVG++G GKST + +L P+ G T Sbjct: 1058 RAGKTVALVGESGSGKSTVISLLQRFYDPDSGHIT 1092 >At3g16340.1 68416.m02066 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza]; contains Pfam profile: PF00005 ABC transporter Length = 1416 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T + +LAG++ Sbjct: 850 RPGVLTALMGVSGAGKTTLMDVLAGRK 876 >At2g47000.1 68415.m05871 multidrug resistant (MDR) ABC transporter, putative similar to multidrug-resistant protein CjMDR1 [Coptis japonica] GI:14715462, MDR-like p-glycoprotein [Arabidopsis thaliana] GI:24324262; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1286 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGRYT 481 R G+ + LVG++G GKST + +L P+ G T Sbjct: 1068 RAGKTVALVGESGSGKSTVIALLQRFYDPDSGEIT 1102 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 G + LVGQ+G GKST + ++ P G Sbjct: 412 GTTVALVGQSGSGKSTVVSLIERFYDPQAG 441 >At1g59870.1 68414.m06745 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1469 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T + +LAG++ Sbjct: 903 RPGVLTALMGVSGAGKTTLMDVLAGRK 929 >At1g53270.1 68414.m06037 ABC transporter family protein contains similarity to ABC transporter GI:10280532 from [Homo sapiens] Length = 590 Score = 31.5 bits (68), Expect = 0.64 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R E+ + G +G GK+T L+ILAGK Sbjct: 59 RSAEITAIAGPSGAGKTTLLEILAGK 84 >At1g15520.1 68414.m01867 ABC transporter family protein similar to ABC1 protein GI:14331118 from [Nicotiana plumbaginifolia] Length = 1423 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T + +LAG++ Sbjct: 861 RPGVLTALMGVSGAGKTTLMDVLAGRK 887 >At1g15210.1 68414.m01818 ABC transporter family protein Similar to gb|Z70524 GI:1514643 PDR5-like ABC transporter from Spirodela polyrrhiza and is a member of the PF|00005 ABC transporter family. ESTs gb|N97039 and gb|T43169 come from this gene Length = 1442 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 RPG + L+G +G GK+T + +LAG++ Sbjct: 876 RPGVLTALMGVSGAGKTTLMDVLAGRK 902 >At5g19410.1 68418.m02313 ABC transporter family protein white membrane transporter, Bactrocera tryoni, EMBL:U97104 Length = 624 Score = 31.1 bits (67), Expect = 0.84 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGK 454 ++L +VG +G GKST LKI++G+ Sbjct: 78 KILAVVGPSGTGKSTLLKIISGR 100 >At3g55100.1 68416.m06119 ABC transporter family protein ATP-binding cassette-sub-family G-member 2, Mus musculus, EMBL:AF140218 Length = 662 Score = 31.1 bits (67), Expect = 0.84 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 + GE+L ++G +G GKST + LAG+ Sbjct: 60 KEGEILAILGASGAGKSTLIDALAGQ 85 >At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PGP1) identical to P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; homologous to mammalian mdr gene,contains ATP-binding cassette; related to multi drug resistance proteins Length = 1286 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 R G+ L LVG +G GKS+ + ++ +P+ GR Sbjct: 1050 RAGKTLALVGPSGCGKSSVISLIQRFYEPSSGR 1082 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 L +P G+ + LVG +G GKST + ++ PN G+ Sbjct: 391 LSVPA-GKTIALVGSSGSGKSTVVSLIERFYDPNSGQ 426 >At5g03910.1 68418.m00371 ABC transporter family protein ABC-type transport protein sll1276, Synechocystis sp., PIR:S77239 Length = 634 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLGR-YTDPPDWQEILLIS 517 + GE + LVG +G GK+T +K+L +P+ G D D ++I L S Sbjct: 421 KAGETVALVGPSGGGKTTLIKLLLRLYEPSSGSIIIDKIDIKDIKLES 468 >At1g71960.1 68414.m08318 ABC transporter family protein similar to breast cancer resistance protein GB:AAC97367 from [Homo sapiens] Length = 662 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK 454 PGE + ++G +G GKST L +AG+ Sbjct: 93 PGEFMAVLGPSGSGKSTLLNAVAGR 117 >At1g51460.1 68414.m05792 ABC transporter family protein similar to SP|Q9UNQ0 ATP-binding cassette, sub-family G, member 2 (Placenta-specific ATP- binding cassette transporter) (Breast cancer resistance protein) {Homo sapiens}; contains Pfam profile PF00005: ABC transporter Length = 678 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 P +L ++G +G GKST L LAG+ N+ Sbjct: 40 PNRILAIMGPSGSGKSTLLDALAGRLAGNV 69 >At5g14100.1 68418.m01649 ABC transporter family protein contains similarity to ABC transporter, ATP-binding protein Length = 278 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +2 Query: 395 GLV-GQNGIGKSTALKILAGKQKPNLG 472 GL+ G++G GK+T L++LAG KP G Sbjct: 81 GLIFGKSGSGKTTLLQLLAGLNKPTSG 107 >At4g25960.1 68417.m03735 multidrug resistance P-glycoprotein, putative similar to multidrug resistant P-glycoprotein GI:4204793 from [Solanum tuberosum] Length = 1233 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 I R G+ + LVGQ+G GKS+ + ++ P G+ Sbjct: 1014 IVRAGKSMALVGQSGSGKSSVISLILRFYDPTAGK 1048 >At4g15230.1 68417.m02333 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1326 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGK 454 I RPG + L+G G GK+T L+ L+GK Sbjct: 163 IVRPGRMTLLLGPPGCGKTTLLQALSGK 190 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 +PG + L+G +G GK+T L +L+G++ Sbjct: 762 KPGVLTSLMGVSGAGKTTLLDVLSGRK 788 >At3g10670.1 68416.m01283 ABC transporter family protein similar to ABC transporter ATPase GB:AAC68280 [Chlamydia trachomatis] Length = 338 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAG 451 GEV ++G+NG GKST K+L G Sbjct: 119 GEVHAVMGKNGSGKSTFSKVLVG 141 >At2g37010.1 68415.m04539 ABC transporter family protein contains ABC transporter domain, Pfam:PF00005 Length = 1063 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK 454 PG V ++G +G GK+T L LAGK Sbjct: 491 PGRVSAVMGPSGAGKTTFLSALAGK 515 >At1g31770.1 68414.m03899 ABC transporter family protein contains Pfam profile: PF00005: ABC transporter Length = 648 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK 454 PGE L ++G +G GK+T L L G+ Sbjct: 91 PGEFLAMLGPSGSGKTTLLSALGGR 115 >At5g46540.1 68418.m05730 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1248 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGKQKPNLGR 475 G+ + LVG++G GKST + +L P+ G+ Sbjct: 1033 GQTVALVGESGSGKSTVISLLERFYDPDSGK 1063 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 L +P G + LVGQ+G GKST + ++ P G Sbjct: 380 LTVPN-GMTVALVGQSGSGKSTVISLIERFYDPESG 414 >At4g30300.1 68417.m04306 ABC transporter family protein ribonuclease L inhibitor - Mus musculus,PIR2:JC6555 Length = 181 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQ 457 +++ ++G+NG GK+T +K+LAG + Sbjct: 21 QIIVMLGENGTGKTTFIKMLAGSK 44 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 667 SVICRMLDLSHIRDREIAALSGGELQRFACAMC 765 S + + L + + D+ LSGGE QR A A+C Sbjct: 97 SDVMKPLKIEELMDKSFNKLSGGEKQRVALALC 129 >At4g15236.1 68417.m02335 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1388 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 +PG + L+G +G GK+T L +L+G++ Sbjct: 824 KPGVLTALMGVSGAGKTTLLDVLSGRK 850 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGKQKPNL 469 I RP + L+G G GK+T L L+G+ P+L Sbjct: 158 IIRPKRMTLLLGPPGCGKTTLLLALSGRLDPSL 190 >At4g15233.1 68417.m02334 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1168 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 +PG + L+G +G GK+T L +L+G++ Sbjct: 745 KPGVLTALMGVSGAGKTTLLDVLSGRK 771 >At4g15215.1 68417.m02332 ABC transporter family protein similar to PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1390 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQ 457 +PG + L+G +G GK+T L +L+G++ Sbjct: 826 KPGVLTSLMGVSGAGKTTLLDVLSGRK 852 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 371 IPRPGEVLGLVGQNGIGKSTALKILAGK 454 I RPG + L+G G GK+T L+ L+G+ Sbjct: 160 IVRPGRMTLLLGPPGCGKTTLLQALSGR 187 >At1g53390.1 68414.m06052 ABC transporter family protein similar to ATP-binding cassette, sub-family G, member 2 (Placenta-specific ATP- binding cassette transporter) (Breast cancer resistance protein) SP:Q9UNQ0 from [Homo sapiens] Length = 1092 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 +PG + ++G +G GK++ L LAGK Sbjct: 515 KPGRITAVMGPSGAGKTSLLSALAGK 540 >At5g13580.1 68418.m01570 ABC transporter family protein Length = 727 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GE+L ++G +G GKST + LA + Sbjct: 117 RDGEILAVLGASGSGKSTLIDALANR 142 >At3g55130.1 68416.m06122 ABC transporter family protein breast cancer resistance protein 1 BCRP1, Mus musculus, EMBL:NP_036050 Length = 725 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +2 Query: 383 GEVLGLVGQNGIGKSTALKILAGK 454 G++L ++G +G GKST + LAG+ Sbjct: 110 GDILAVLGASGAGKSTLIDALAGR 133 >At3g55090.1 68416.m06118 ABC transporter family protein ATP-binding cassette-sub-family G-member 2, Mus musculus, EMBL:AF140218 Length = 720 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GE+L ++G +G GKST + LA + Sbjct: 100 RDGEILAVLGASGSGKSTLIDALANR 125 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 365 LPIPRPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 L IP G+ + LVG +G GKST + +L PN G Sbjct: 299 LKIPS-GKTVALVGGSGSGKSTVISLLQRFYDPNEG 333 >At5g01670.2 68418.m00084 aldose reductase, putative similar to aldose reductase [Hordeum vulgare][GI:728592], aldose reductase ALDRXV4 [Xerophyta viscosa][GI:4539944] Length = 349 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +1 Query: 574 LIKPQYVDQIPKAVKGTVGQLLDKKDEMKNQSVICRMLDLSHIRD 708 LI Q VD+I K + T GQ+L K + SVI + L+ I++ Sbjct: 253 LIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKE 297 >At5g01670.1 68418.m00083 aldose reductase, putative similar to aldose reductase [Hordeum vulgare][GI:728592], aldose reductase ALDRXV4 [Xerophyta viscosa][GI:4539944] Length = 322 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +1 Query: 574 LIKPQYVDQIPKAVKGTVGQLLDKKDEMKNQSVICRMLDLSHIRD 708 LI Q VD+I K + T GQ+L K + SVI + L+ I++ Sbjct: 226 LIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKE 270 >At5g57960.1 68418.m07252 GTP-binding family protein similar to SP|P25519 GTP-binding protein hflX {Escherichia coli} Length = 540 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 332 RYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAG 451 R + ++ R+ IP P V+ LVG GKST L L G Sbjct: 294 RKHRKQYRSRRVAIPVP--VVSLVGYTNAGKSTLLNQLTG 331 >At2g39350.1 68415.m04830 ABC transporter family protein Length = 740 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GE++ ++G +G GKST + LA + Sbjct: 118 RDGEIMAVLGASGSGKSTLIDALANR 143 >At2g33520.1 68415.m04109 expressed protein Length = 97 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 331 PLLQKLIQAPSPAYPKTR 384 PL Q +I+AP P YP TR Sbjct: 18 PLYQPIIEAPPPPYPPTR 35 >At1g17840.1 68414.m02208 ABC transporter family protein similar to ABC transporter GI:10280532 from [Homo sapiens] Length = 703 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPN 466 PG + L+G +G GKST L LA + N Sbjct: 79 PGSLTALMGPSGSGKSTMLDALASRLAAN 107 >At5g60740.1 68418.m07621 ABC transporter family protein similar to ATP-binding cassette, sub-family G, member 2 (Placenta-specific ATP- binding cassette transporter) (Breast cancer resistance protein) SP:Q9UNQ0 from [Homo sapiens] Length = 1061 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGK 454 PG V ++G +G GK+T L L GK Sbjct: 525 PGRVSAVMGPSGAGKTTFLTALTGK 549 >At3g28860.1 68416.m03602 multidrug resistance P-glycoprotein, putative similar to mdr-like P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; contains Pfam profiles PF00005: ABC transporter and PF00664: ABC transporter transmembrane region; identical to cDNA MDR-like p-glycoprotein (At3g28860) GI:24324261 Length = 1252 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = +2 Query: 272 PFDAITIINIPSNLE-KHTTHRYSKNS----FKLHRLPIPRPGEVLGLVGQNGIGKSTAL 436 P D + + N+E K T Y F+ + P G+ + +VG +G GKST + Sbjct: 352 PLDGKCLDQVHGNIEFKDVTFSYPSRPDVMIFRNFNIFFPS-GKTVAVVGGSGSGKSTVV 410 Query: 437 KILAGKQKPNLGR 475 ++ PN G+ Sbjct: 411 SLIERFYDPNSGQ 423 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 441 IFSAVDFPIPFWPTRPRTSPGLGIGRRWS 355 + SA FP+P P P+ PGL +GRR S Sbjct: 1000 VSSAHKFPVPVNPMMPQPLPGL-VGRRQS 1027 >At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1556 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 386 EVLGLVGQNGIGKSTALKILAGKQKPNLGRY 478 +V+GL G GIGK+T K K N R+ Sbjct: 385 QVMGLYGMGGIGKTTLAKAFYNKIIVNFNRH 415 >At5g43500.1 68418.m05319 expressed protein Length = 596 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 279 MLSPSSISHLTWRNTLPTVTP 341 M P S SHL+W++ L TV P Sbjct: 1 MAKPKSNSHLSWQDYLKTVAP 21 >At3g53510.1 68416.m05908 ABC transporter family protein breast cancer resistance protein (BCRP), Homo sapiens, EMBL:AF098951 Length = 739 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GE++ ++G +G GKST + LA + Sbjct: 135 REGEMMAVLGASGSGKSTLIDALANR 160 >At3g13090.1 68416.m01639 ABC transporter, putative similar to MRP-like ABC transporter [Arabidopsis thaliana] GI:2316016; contains Pfam profile: PF00005 ABC transporter Length = 1466 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 356 LHRLPIPRPGEV-LGLVGQNGIGKSTALKILAGKQKPNLG 472 LH L PG + G+VG+ G GKST ++ L +P G Sbjct: 1236 LHGLTCTFPGGLKTGIVGRTGCGKSTLIQTLFRIVEPAAG 1275 >At2g37360.1 68415.m04582 ABC transporter family protein Length = 755 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGK 454 R GE++ ++G +G GKST + LA + Sbjct: 142 REGEMMAVLGASGSGKSTLIDALANR 167 >At2g28070.1 68415.m03408 ABC transporter family protein Length = 730 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 380 PGEVLGLVGQNGIGKSTALKILAGKQKPNLGRY 478 PG + ++G GKST L+ LAG+ P+ Y Sbjct: 143 PGTMTVIMGPAKSGKSTLLRALAGRLPPSAKMY 175 >At1g27940.1 68414.m03423 multidrug resistance P-glycoprotein, putative similar to mdr-like P-glycoprotein atpgp1 GI:3849833 from [Arabidopsis thaliana] Length = 1245 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 377 RPGEVLGLVGQNGIGKSTALKILAGKQKPNLG 472 R G+ VG +G GKST + ++ +PN G Sbjct: 397 RSGKTFAFVGPSGSGKSTIISMVQRFYEPNSG 428 >At1g07620.1 68414.m00817 GTP1/OBG family protein similar to SP|P20964 Spo0B-associated GTP-binding protein {Bacillus subtilis}; contains Pfam profile PF01018: GTP1/OBG family Length = 1016 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 392 LGLVGQNGIGKSTALKILAGKQKPNLGRY 478 +GLVG GKST L L+ + KP +G Y Sbjct: 829 VGLVGMPNAGKSTLLGALS-RAKPRVGHY 856 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,847,239 Number of Sequences: 28952 Number of extensions: 396363 Number of successful extensions: 1429 Number of sequences better than 10.0: 99 Number of HSP's better than 10.0 without gapping: 1334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1429 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -