BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30111 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 25 0.91 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.1 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 6.4 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 24.6 bits (51), Expect = 0.91 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +1 Query: 34 ERTLPKTHSSTLESTIIKAGNVTFGQLLVNQKIELLTLYSIGSHKTLLNDILDK*QVK 207 E TLP ++ GN + VN +++ LY ++ L++ +K VK Sbjct: 70 EETLPSLPDRKFQTVTSIEGNTFKTETQVNDSLKVTRLYEFSDNELLVHISTNKSDVK 127 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/30 (30%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 295 HFFVQM-HRLPPLIIDDSLSFYVKLTQYYW 381 HF+ + H PP ++ +SL+F ++Y+ Sbjct: 230 HFYFMLNHNYPPFMLSNSLNFPQIRGEFYF 259 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/30 (30%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 295 HFFVQM-HRLPPLIIDDSLSFYVKLTQYYW 381 HF+ + H PP ++ +SL+F ++Y+ Sbjct: 230 HFYFMLNHNYPPFMLSNSLNFPQIRGEFYF 259 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.8 bits (44), Expect = 6.4 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 25 TLGERTLPKTHSSTLESTIIKAGNVTFGQLLVNQKIELLTLYSI 156 TLG R L + +GNV G LLV ++ L+L +I Sbjct: 219 TLGRRILRLDAIDEASIAVGASGNVFAGYLLVFIGLQSLSLTNI 262 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,876 Number of Sequences: 438 Number of extensions: 3101 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -