BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30110 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containi... 46 2e-05 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 46 3e-05 At3g17970.1 68416.m02286 chloroplast outer membrane translocon s... 46 3e-05 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 43 2e-04 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 41 7e-04 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 41 9e-04 At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containi... 40 0.001 At5g10090.1 68418.m01169 tetratricopeptide repeat (TPR)-containi... 40 0.002 At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containi... 35 0.058 At5g09420.1 68418.m01091 chloroplast outer membrane translocon s... 33 0.23 At1g78120.1 68414.m09104 tetratricopeptide repeat (TPR)-containi... 32 0.31 At4g12400.1 68417.m01960 stress-inducible protein, putative simi... 32 0.41 At5g21990.1 68418.m02557 tetratricopeptide repeat (TPR)-containi... 31 0.54 At2g42810.1 68415.m05300 serine/threonine protein phosphatase, p... 31 0.54 At1g56090.1 68414.m06441 tetratricopeptide repeat (TPR)-containi... 31 0.94 At1g32240.1 68414.m03966 myb family transcription factor (KAN2) ... 31 0.94 At1g12270.1 68414.m01419 stress-inducible protein, putative simi... 31 0.94 At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-conta... 30 1.2 At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / F... 30 1.2 At3g16760.2 68416.m02140 tetratricopeptide repeat (TPR)-containi... 30 1.2 At3g16760.1 68416.m02139 tetratricopeptide repeat (TPR)-containi... 30 1.2 At2g41520.2 68415.m05131 DNAJ heat shock N-terminal domain-conta... 30 1.2 At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-conta... 30 1.2 At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, pu... 30 1.6 At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containi... 30 1.6 At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containi... 30 1.6 At1g58450.1 68414.m06649 peptidyl-prolyl cis-trans isomerase FKB... 29 2.2 At1g56440.1 68414.m06491 serine/threonine protein phosphatase-re... 29 2.2 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 29 2.2 At4g27710.1 68417.m03983 cytochrome P450 family protein contains... 29 2.9 At1g62740.1 68414.m07081 stress-inducible protein, putative simi... 29 2.9 At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.8 At1g18660.4 68414.m02326 zinc finger (C3HC4-type RING finger) fa... 29 3.8 At1g18660.3 68414.m02329 zinc finger (C3HC4-type RING finger) fa... 29 3.8 At1g18660.2 68414.m02328 zinc finger (C3HC4-type RING finger) fa... 29 3.8 At1g18660.1 68414.m02327 zinc finger (C3HC4-type RING finger) fa... 29 3.8 At5g55000.2 68418.m06850 potassium channel tetramerisation domai... 28 5.0 At5g55000.1 68418.m06849 potassium channel tetramerisation domai... 28 5.0 At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain... 28 5.0 At3g04850.1 68416.m00526 tesmin/TSO1-like CXC domain-containing ... 28 5.0 At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containi... 28 6.6 At2g46950.1 68415.m05864 cytochrome P450 family protein similar ... 28 6.6 At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.6 At1g62390.1 68414.m07039 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.6 At4g32560.2 68417.m04635 paramyosin-related contains weak simila... 27 8.8 At4g32560.1 68417.m04634 paramyosin-related contains weak simila... 27 8.8 At3g14110.2 68416.m01783 tetratricopeptide repeat (TPR)-containi... 27 8.8 At3g14110.1 68416.m01784 tetratricopeptide repeat (TPR)-containi... 27 8.8 At3g11540.2 68416.m01408 gibberellin signal transduction protein... 27 8.8 At3g11540.1 68416.m01407 gibberellin signal transduction protein... 27 8.8 At1g49210.1 68414.m05517 zinc finger (C3HC4-type RING finger) fa... 27 8.8 At1g49200.1 68414.m05516 zinc finger (C3HC4-type RING finger) fa... 27 8.8 At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi... 27 8.8 >At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 593 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Frame = +2 Query: 245 GYRA-IYVRGLCLYFEDRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAF 421 GY + VR R ++A + Q+ +L+ ++++ + +RA+ + + + +GNE F Sbjct: 422 GYAGFLVVRAQVHLASGRFDEAVEAIQRAGKLDGNNREVIMISRRAQAVTEARFKGNELF 481 Query: 422 KMGRWQQALALYNEALTIDKNN 487 K GR+Q+A A Y E L D N Sbjct: 482 KSGRFQEACAAYGEGLDHDPRN 503 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 407 GNEAFKMGRWQQALALYNEALTIDKN 484 GNE +K G + +ALALY+ A+ ID N Sbjct: 243 GNEDYKNGNFAEALALYDAAIAIDPN 268 Score = 30.7 bits (66), Expect = 0.94 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKDYERL 680 Y KA LRRA C ++ ++E AV DYE L Sbjct: 537 YGKARLRRADCNAKIEKWELAVGDYEIL 564 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/85 (27%), Positives = 43/85 (50%) Frame = +2 Query: 254 AIYVRGLCLYFEDRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGR 433 A+ +RG Y+ + A +H+Q+ LRL+P+H + + Y K L +K + + G+ Sbjct: 201 ALLLRGRAYYYLADHDIAQRHYQKGLRLDPEHSELKKAYFGLKKLLKKTKSAEDNANKGK 260 Query: 434 WQQALALYNEALTIDKNNRTVNAKL 508 + + Y EA+ +D + N L Sbjct: 261 LRVSAEEYKEAIALDPEHTANNVHL 285 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +3 Query: 24 ELRALETLKRLHEDAQRALDANDYRRVVFCMDRC-LDYSPSCTKCKLTKAECLALLGRCQ 200 EL L K E A ++ D + + +D+ L +SP+C+K KL K + L + Sbjct: 123 ELSQLHQAKSALETASTLYESKDIAKALEFVDKVVLVFSPACSKAKLLKVKLLMVSKDYS 182 Query: 201 EAQEIANDLLRLDSQDTE 254 A +L+ D + E Sbjct: 183 GAISETGYILKEDENNLE 200 >At3g17970.1 68416.m02286 chloroplast outer membrane translocon subunit, putative similar to Toc64 [Pisum sativum] GI:7453538; contains Pfam profile PF00515 TPR Domain Length = 589 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/68 (30%), Positives = 37/68 (54%) Frame = +2 Query: 290 DRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEAL 469 D + + Q+ + D K + + + + + KE+GN+AFK WQ+A+ LY+EA+ Sbjct: 442 DTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEKGNQAFKEKLWQKAIGLYSEAI 501 Query: 470 TIDKNNRT 493 + NN T Sbjct: 502 KLSDNNAT 509 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 +Y+KALLRRA Y +LG +E+AVKDYE L Sbjct: 524 SYIKALLRRAASYGKLGRWEDAVKDYEFL 552 Score = 35.5 bits (78), Expect = 0.033 Identities = 17/65 (26%), Positives = 30/65 (46%) Frame = +2 Query: 293 RDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALT 472 R E A ++ L+ + + V K++ + + GNE F GR+ +A Y + L Sbjct: 427 RFENAVVKAERAAMLDQTNPEVVSVLNNVKMVVRARTRGNELFSSGRFSEACVAYGDGLK 486 Query: 473 IDKNN 487 D +N Sbjct: 487 QDDSN 491 Score = 32.7 bits (71), Expect = 0.23 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +2 Query: 353 KAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALTIDKNN 487 KAV + + ++ K GN+ ++ G + +AL+LY+ A+ I N Sbjct: 209 KAVRVAENGENPEELKRMGNDMYRRGSFSEALSLYDRAILISPGN 253 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/68 (25%), Positives = 38/68 (55%) Frame = +2 Query: 293 RDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALT 472 R E A ++ +++P + + YK +L+ + ++ GN+ +++ R+ +A + Y E L Sbjct: 465 RFENAVVTAEKASKIDPQNNEVEILYKNVRLITRARDRGNDLYELERYTEARSAYAEGLK 524 Query: 473 IDKNNRTV 496 D +N T+ Sbjct: 525 YDPSNATL 532 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 +Y K L+RA YT+L + EAV DYE L Sbjct: 562 SYTKPRLQRAALYTKLERWAEAVSDYEIL 590 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 389 KQKKEEGNEAFKMGRWQQALALYNEALTIDKNNRTVNA 502 ++ K GNE F+ G + +AL LY+ A+ + +N T ++ Sbjct: 259 EEVKRFGNEMFRKGCFAEALKLYDRAIELSPSNATYHS 296 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 +Y KALLRRA Y +LG +E+AV+DYE L Sbjct: 515 SYTKALLRRAASYGKLGRWEDAVRDYEVL 543 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +2 Query: 389 KQKKEEGNEAFKMGRWQQALALYNEALTIDKNNRTVNAKLTSTRPPSVRXEHA 547 ++ K+ GN ++ G + +ALALY+ A+++ N + + S R E A Sbjct: 212 EEVKKAGNVMYRKGNYAEALALYDRAISLSPENPAYRSNRAAALAASGRLEEA 264 Score = 31.5 bits (68), Expect = 0.54 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +2 Query: 293 RDEQAFKHFQQVLRLNPDHK-KAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEAL 469 R E A ++ + ++ + + V K + + + GNE F GR+ +A Y + L Sbjct: 417 RFENAIVKVERAMTIDHSNSPEVVSVLNNVKNVAKARTRGNELFSSGRYSEASVAYGDGL 476 Query: 470 TIDKNN 487 +D N Sbjct: 477 KLDAFN 482 >At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containing protein low similarity to protein antigen LmSTI1 [Leishmania major] GI:1698880; contains Pfam profile PF00515 TPR Domain; EST gb|Z47802 and gb|Z48402 come from this gene Length = 328 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +2 Query: 350 KKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALTIDKNNRTV 496 +KA + + K KE+GNE FK G + +A ALY +A+ +D +N T+ Sbjct: 3 EKAGKATNGGEAEKSLKEKGNEFFKAGNFLKAAALYTQAIKLDPSNATL 51 >At5g10090.1 68418.m01169 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 594 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/62 (29%), Positives = 34/62 (54%) Frame = +2 Query: 302 QAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALTIDK 481 +A + Q+ +L+ ++++ +RA+ + + GN+ FK GR+Q+A Y E L D Sbjct: 443 EAVEAIQRAGKLDGNNREVSMVLRRAQAVTAARSRGNDFFKAGRFQEACTAYGEGLDHDS 502 Query: 482 NN 487 N Sbjct: 503 RN 504 Score = 36.7 bits (81), Expect = 0.014 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKDYERL 680 Y KA LRRA C +LG +E AV DYE L Sbjct: 538 YTKARLRRADCNAKLGNWESAVGDYEIL 565 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 407 GNEAFKMGRWQQALALYNEALTID 478 GNE +K G + +ALALY A++ID Sbjct: 244 GNEDYKNGNFAEALALYEAAISID 267 >At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 883 Score = 34.7 bits (76), Expect = 0.058 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYE 674 N ++ L R CY +GEY +AVKDY+ Sbjct: 532 NTIECLYLRGSCYHAVGEYRDAVKDYD 558 >At5g09420.1 68418.m01091 chloroplast outer membrane translocon subunit, putative similar to component of chloroplast outer membrane translocon Toc64 [Pisum sativum] GI:7453538; contains Pfam profiles PF01425: Amidase, PF00515: TPR Domain Length = 603 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 398 KEEGNEAFKMGRWQQALALYNEALTIDKNNRT 493 KE+GN A+K +W +A+ Y EA+ ++ N T Sbjct: 492 KEKGNAAYKGKQWNKAVNFYTEAIKLNGANAT 523 >At1g78120.1 68414.m09104 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 530 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/76 (23%), Positives = 34/76 (44%) Frame = +2 Query: 293 RDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALT 472 R E A +Q RL+P ++ ++A+ + + GN F +++ A +Y E L Sbjct: 363 RFEDAVTASRQAARLDPSSEEVNAVARKARAVASARLSGNLLFNASKFEGASVVYTEGLE 422 Query: 473 IDKNNRTVNAKLTSTR 520 D N + ++R Sbjct: 423 NDPYNALLLCNRAASR 438 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 +Y KA RRA Y +L +++ A++DYE L Sbjct: 460 SYRKARRRRADSYAKLEKWQHAIQDYELL 488 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 398 KEEGNEAFKMGRWQQALALYNEALTIDKNNRT 493 K+ GNE + GR+ QAL Y A++ D T Sbjct: 163 KKMGNEEYCRGRFGQALVFYERAISADPKTPT 194 >At4g12400.1 68417.m01960 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 530 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYER 677 N V+A RA CYT+LG E +KD E+ Sbjct: 401 NDVRAYSNRAACYTKLGALPEGLKDAEK 428 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 600 VKALLRRAKCYTELGEYEEAVKDYER 677 + L RA Y E+G+YEE ++D ++ Sbjct: 264 ISYLTNRAAVYLEMGKYEECIEDCDK 289 >At5g21990.1 68418.m02557 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 554 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 600 VKALLRRAKCYTELGEYEEAVKDYERLY 683 VKAL RR + Y +LG +E+AV D + + Sbjct: 180 VKALYRRGQAYRDLGLFEDAVSDLSKAH 207 >At2g42810.1 68415.m05300 serine/threonine protein phosphatase, putative similar to SP|P53042 Serine/threonine protein phosphatase 5 (EC 3.1.3.16) (PP5) (Protein phosphatase T) (PPT) {Rattus norvegicus}; contains Pfam profiles PF00149: Ser/Thr protein phosphatase, PF00515: TPR Domain Length = 484 Score = 31.5 bits (68), Expect = 0.54 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 398 KEEGNEAFKMGRWQQALALYNEALTIDKNN 487 K + NEAFK ++ A+ LY +A+ ++ NN Sbjct: 17 KSQANEAFKGHKYSSAIDLYTKAIELNSNN 46 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +2 Query: 251 RAIYVRGLCLYFEDRDEQAFKHFQQVLRLNPDHKKAVETYKRAK--LLKQKKEE 406 + Y RG + + A K FQQV RL+P+ A K + ++K K EE Sbjct: 82 KGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRKLKECEKAVMKLKFEE 135 >At1g56090.1 68414.m06441 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain; similar to infertility-related sperm protein [Homo sapiens] GI:10863768, TPR-containing protein involved in spermatogenesis TPIS [Mus musculus] GI:6272680 Length = 272 Score = 30.7 bits (66), Expect = 0.94 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 395 KKEEGNEAFKMGRWQQALALYNEALTIDK 481 K E+G++ ++ G++++AL Y EALT K Sbjct: 10 KVEKGHQLYRDGKYKEALLFYTEALTAAK 38 >At1g32240.1 68414.m03966 myb family transcription factor (KAN2) contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA GARP-like putative transcription factor KANADI2 (KAN2) GI:15723594 Length = 388 Score = 30.7 bits (66), Expect = 0.94 Identities = 14/57 (24%), Positives = 31/57 (54%) Frame = +2 Query: 329 LRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALTIDKNNRTVN 499 L+++P + K T++R + +E +E +G W++AL +L + ++T+N Sbjct: 12 LQISPPNSKPSSTWQRRR--STTDQEDHEELDLGFWRRALDSRTSSLVSNSTSKTIN 66 >At1g12270.1 68414.m01419 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 572 Score = 30.7 bits (66), Expect = 0.94 Identities = 17/67 (25%), Positives = 34/67 (50%) Frame = +2 Query: 287 EDRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEA 466 E R+ K R + ++ + Y KL +++E+GN+ FK ++ +A+ Y EA Sbjct: 352 EHRNPDTLKRLNDAERAKKEWEQ--KQYFDPKLGDEEREKGNDFFKEQKYPEAIKHYTEA 409 Query: 467 LTIDKNN 487 + + N+ Sbjct: 410 IKRNPND 416 >At5g12430.1 68418.m01461 DNAJ heat shock N-terminal domain-containing protein similarity to TETRATRICOPEPTIDE REPEAT PROTEIN 2 , human, SWISSPROT:TTC2_HUMAN; contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1165 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYER 677 N++K +R A CY LGE E+A + +++ Sbjct: 684 NFLKVQVRAANCYLSLGEIEDASRYFKK 711 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYER 677 NY KA+ RRA + + +Y +A D ER Sbjct: 949 NYSKAISRRATLFEMIRDYGQAASDMER 976 >At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / FK506-binding protein (ROF1) identical to rotamase FKBP (ROF1) GB:U49453 [Arabidopsis thaliana] (Mol. Gen. Genet. 252 (5), 510-517 (1996)) Length = 551 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 359 VETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEAL 469 + T ++ + +KKEEGN FK G++ A Y +A+ Sbjct: 391 MNTEEKIEAASKKKEEGNSKFKGGKYSLASKRYEKAV 427 >At3g16760.2 68416.m02140 tetratricopeptide repeat (TPR)-containing protein low similarity to TPR-containing protein involved in spermatogenesis TPIS [Mus musculus] GI:6272682; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 456 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 603 KALLRRAKCYTELGEYEEAVKD 668 + L RA CY E+GEY++AV D Sbjct: 375 EVLSTRASCYKEVGEYKKAVAD 396 >At3g16760.1 68416.m02139 tetratricopeptide repeat (TPR)-containing protein low similarity to TPR-containing protein involved in spermatogenesis TPIS [Mus musculus] GI:6272682; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 475 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 603 KALLRRAKCYTELGEYEEAVKD 668 + L RA CY E+GEY++AV D Sbjct: 394 EVLSTRASCYKEVGEYKKAVAD 415 >At2g41520.2 68415.m05131 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1077 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 NY KA+ RRA + + +Y++A D +RL Sbjct: 871 NYTKAVSRRATLHEMIRDYDQAASDLQRL 899 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYER 677 +Y+KA +R A C+ LGE AV+ + + Sbjct: 629 SYIKAYMRAANCHLVLGELGSAVQYFNK 656 >At2g41520.1 68415.m05130 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 1108 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 NY KA+ RRA + + +Y++A D +RL Sbjct: 902 NYTKAVSRRATLHEMIRDYDQAASDLQRL 930 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYER 677 +Y+KA +R A C+ LGE AV+ + + Sbjct: 629 SYIKAYMRAANCHLVLGELGSAVQYFNK 656 >At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative similar to rof1 [Arabidopsis thaliana] GI:1373396 Length = 578 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 359 VETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEAL 469 + T +R + +KKEEGN FK G++ +A Y + Sbjct: 401 MNTQERIEAAGKKKEEGNVLFKAGKYARASKRYERGV 437 >At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 277 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKDYERL 680 Y KAL+RRA+ + +L +E+AV D +++ Sbjct: 179 YNKALVRRAEAHEKLEHFEDAVTDLKKI 206 >At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containing protein / U-box domain-containing protein similar to serologically defined colon cancer antigen 7 GB:5031963 GI:3170178 [Homo sapiens]; Length = 278 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 383 LLKQKKEEGNEAFKMGRWQQALALYNEALTIDKN 484 + ++ KE+GN FK R+ A+ Y EA+ + N Sbjct: 9 MAERLKEDGNNCFKKERFGAAIDAYTEAIALSPN 42 >At1g58450.1 68414.m06649 peptidyl-prolyl cis-trans isomerase FKBP-type family protein similar to rof1 from (Arabidopsis thaliana) GI:1373396, GI:1354207; contains Pfam profile PF00515 TPR Domain Length = 164 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 371 KRAKLLKQKKEEGNEAFKMGRWQQALALYNEALTIDKNNR 490 ++ + +KKEEGN +K ++++A YN+A +N + Sbjct: 5 EKIEAANRKKEEGNLLYKTQKYERAAKKYNKAAECIENGK 44 >At1g56440.1 68414.m06491 serine/threonine protein phosphatase-related similar to SP|Q60676 Serine/threonine protein phosphatase 5 (EC 3.1.3.16) (PP5) (Protein phosphatase T) (PPT) Mus musculus, Tetratricopeptide Repeats Of Protein Phosphatase 5 [Homo sapiens] GI:3212250; contains Pfam profile: PF00515: TPR Domain Length = 476 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 395 KKEEGNEAFKMGRWQQALALYNEALTIDKN 484 +KE+GNE FK ++ +A+ Y+ ++ + N Sbjct: 87 EKEQGNEFFKQKKFNEAIDCYSRSIALSPN 116 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 389 KQKKEEGNEAFKMGRWQQALALYNEALTIDKNN 487 ++ K GNE ++ G + +AL LY+ A+ + N Sbjct: 228 EEVKRVGNEMYRKGLFNEALKLYDRAIALSPTN 260 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 594 NYVKALLRRAKCYTELGEYEEAVKDYERL 680 +Y K LLRRA +++ + AV DYE L Sbjct: 531 SYTKPLLRRAASNSKMERWGAAVSDYEAL 559 >At4g27710.1 68417.m03983 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 518 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 297 SLSSKYKHSPLTYIALYPDYQVVV 226 SLS +YKH+P+ + L+P Y + V Sbjct: 489 SLSPEYKHTPVDHFDLFPQYGLPV 512 >At1g62740.1 68414.m07081 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 571 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 603 KALLRRAKCYTELGEYEEAVKDYER 677 +A RA CYT+LG E +KD E+ Sbjct: 417 RAYSNRAACYTKLGAMPEGLKDAEK 441 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/61 (22%), Positives = 31/61 (50%) Frame = +2 Query: 287 EDRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEA 466 E R+ + K + R + ++ + Y + +++E+GN+ FK ++ A+ Y EA Sbjct: 351 EHRNPETLKRLNEAERAKKELEQ--QEYYDPNIGDEEREKGNDFFKEQKYPDAVRHYTEA 408 Query: 467 L 469 + Sbjct: 409 I 409 >At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 811 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKD 668 Y KAL+RR++CY L + + A +D Sbjct: 124 YSKALVRRSRCYEALNKLDYAFRD 147 >At1g18660.4 68414.m02326 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 491 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/28 (39%), Positives = 22/28 (78%) Frame = +2 Query: 392 QKKEEGNEAFKMGRWQQALALYNEALTI 475 Q E+GN++FK R+++A++ Y++A +I Sbjct: 41 QLVEKGNQSFKESRFEEAISSYSKANSI 68 >At1g18660.3 68414.m02329 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 486 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/28 (39%), Positives = 22/28 (78%) Frame = +2 Query: 392 QKKEEGNEAFKMGRWQQALALYNEALTI 475 Q E+GN++FK R+++A++ Y++A +I Sbjct: 41 QLVEKGNQSFKESRFEEAISSYSKANSI 68 >At1g18660.2 68414.m02328 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 486 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/28 (39%), Positives = 22/28 (78%) Frame = +2 Query: 392 QKKEEGNEAFKMGRWQQALALYNEALTI 475 Q E+GN++FK R+++A++ Y++A +I Sbjct: 41 QLVEKGNQSFKESRFEEAISSYSKANSI 68 >At1g18660.1 68414.m02327 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type Length = 486 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/28 (39%), Positives = 22/28 (78%) Frame = +2 Query: 392 QKKEEGNEAFKMGRWQQALALYNEALTI 475 Q E+GN++FK R+++A++ Y++A +I Sbjct: 41 QLVEKGNQSFKESRFEEAISSYSKANSI 68 >At5g55000.2 68418.m06850 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein contains Pfam profiles PF02214: K+ channel tetramerisation domain, PF00805: Pentapeptide repeats (8 copies) Length = 298 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 213 SPGLPGSVLATLSIQLLSVYIWCKRGCSLGNGPYRTLHVDN 91 S L G++LA ++Q ++ C GCS RT H+ N Sbjct: 195 SANLRGALLAGTNLQSANLQDACLVGCSFCGADLRTAHLQN 235 >At5g55000.1 68418.m06849 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein contains Pfam profiles PF02214: K+ channel tetramerisation domain, PF00805: Pentapeptide repeats (8 copies) Length = 290 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 213 SPGLPGSVLATLSIQLLSVYIWCKRGCSLGNGPYRTLHVDN 91 S L G++LA ++Q ++ C GCS RT H+ N Sbjct: 195 SANLRGALLAGTNLQSANLQDACLVGCSFCGADLRTAHLQN 235 >At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 809 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 603 KALLRRAKCYTELGEYEEAVKD 668 KALL+RA+CY L + + A++D Sbjct: 201 KALLKRARCYEALNKLDLALRD 222 >At3g04850.1 68416.m00526 tesmin/TSO1-like CXC domain-containing protein similar to CXC domain containing TSO1-like protein 1 (SOL1) [Arabidopsis thaliana] GI:7767427, CXC domain protein TSO1 [Arabidopsis thaliana] GI:7767425; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 639 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 126 LDYSPSCTKCKLTKAECLALLGRCQEA 206 LD SC +CK K++CL L C A Sbjct: 446 LDELGSCKRCKCRKSQCLKLYCECFSA 472 >At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containing protein glutamine-rich tetratricopeptide repeat (TPR) containing protein (SGT) - Rattus norvegicus,PID:e1285298 (SP|O70593); contains Pfam profile PF00515 TPR Domain Length = 426 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 335 LNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQALALYNEALTI-DKN 484 +N K +T+ L + K +GN+A + + +A+ LY+ A+ + DKN Sbjct: 158 VNEMEKSGCQTFDVNSLAETLKCQGNKAMQSNLYLEAVELYSFAIALTDKN 208 >At2g46950.1 68415.m05864 cytochrome P450 family protein similar to cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; contains Pfam profile: PF00067: Cytochrome P450 Length = 572 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 297 SLSSKYKHSPLTYIALYPDYQVVV 226 +LS+ YKH+P ++ L P Y + V Sbjct: 542 NLSADYKHAPADHLTLQPQYDLPV 565 >At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 697 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKD 668 + KALL+RA+CY L + + A +D Sbjct: 125 FSKALLKRARCYEALNKLDFAFRD 148 >At1g62390.1 68414.m07039 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 751 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKD 668 + +ALLRRA+ + +G+++ AV+D Sbjct: 124 FTRALLRRARAFEAVGKFDLAVQD 147 >At4g32560.2 68417.m04635 paramyosin-related contains weak similarity to Paramyosin (Swiss-Prot:P10567) [Caenorhabditis elegans] Length = 306 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKDYERL 680 Y+ A + KCYT L Y+E ERL Sbjct: 268 YIAAAAEQRKCYTVLRAYQEECTKNERL 295 >At4g32560.1 68417.m04634 paramyosin-related contains weak similarity to Paramyosin (Swiss-Prot:P10567) [Caenorhabditis elegans] Length = 306 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKDYERL 680 Y+ A + KCYT L Y+E ERL Sbjct: 268 YIAAAAEQRKCYTVLRAYQEECTKNERL 295 >At3g14110.2 68416.m01783 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 232 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 621 AKCYTELGEYEEAVKDYE 674 A CYTELG+ E+A K Y+ Sbjct: 206 ADCYTELGDLEKAGKFYD 223 >At3g14110.1 68416.m01784 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 316 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 621 AKCYTELGEYEEAVKDYE 674 A CYTELG+ E+A K Y+ Sbjct: 290 ADCYTELGDLEKAGKFYD 307 >At3g11540.2 68416.m01408 gibberellin signal transduction protein (SPINDLY) identical to spindly GB:AAC49446 (GI:1589778) [Arabidopsis thaliana]; contains Pfam profile PF00515 TPR Domain Length = 732 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +2 Query: 266 RGLCLYFEDRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQA 445 +G+CL +++ AF F + +RL+P H T+ +L KEEG +Q+A Sbjct: 83 KGICLQTQNKGNLAFDCFSEAIRLDP-HNACALTH--CGIL--HKEEGRLVEAAESYQKA 137 Query: 446 L 448 L Sbjct: 138 L 138 >At3g11540.1 68416.m01407 gibberellin signal transduction protein (SPINDLY) identical to spindly GB:AAC49446 (GI:1589778) [Arabidopsis thaliana]; contains Pfam profile PF00515 TPR Domain Length = 914 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +2 Query: 266 RGLCLYFEDRDEQAFKHFQQVLRLNPDHKKAVETYKRAKLLKQKKEEGNEAFKMGRWQQA 445 +G+CL +++ AF F + +RL+P H T+ +L KEEG +Q+A Sbjct: 83 KGICLQTQNKGNLAFDCFSEAIRLDP-HNACALTH--CGIL--HKEEGRLVEAAESYQKA 137 Query: 446 L 448 L Sbjct: 138 L 138 >At1g49210.1 68414.m05517 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 225 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 105 VFCMDRCLDYSPSCTKCKLTKAE-CLALLGRCQEAQEIAN 221 V C+D+ L + +C KC+ E C +LG +A +A+ Sbjct: 160 VRCIDKWLQHHLTCPKCRHCLVETCQKILGDFSQADSMAS 199 >At1g49200.1 68414.m05516 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 226 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 105 VFCMDRCLDYSPSCTKCKLTKAE-CLALLGRCQEAQEIA 218 V C+D+ L +C KC+ E C +LG +A ++A Sbjct: 161 VRCIDKWLQQHLTCPKCRHCLVETCQKILGDFSQADQVA 199 >At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 798 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 597 YVKALLRRAKCYTELGEYEEAVKD 668 Y KA RR K T LG Y++A +D Sbjct: 139 YAKAWYRRGKLNTLLGNYKDAFRD 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,949,051 Number of Sequences: 28952 Number of extensions: 244912 Number of successful extensions: 850 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -