BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30106 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78015-1|CAB01433.1| 206|Caenorhabditis elegans Hypothetical pr... 27 9.6 Z50027-2|CAA90335.1| 188|Caenorhabditis elegans Hypothetical pr... 27 9.6 >Z78015-1|CAB01433.1| 206|Caenorhabditis elegans Hypothetical protein R02D5.1 protein. Length = 206 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 170 NLCSTLQKDSTGKGRDSPSPQYRQTPSL 87 N+CS+L+ ST R PSP+ P L Sbjct: 46 NVCSSLKMKSTKPSRKRPSPKESDLPPL 73 >Z50027-2|CAA90335.1| 188|Caenorhabditis elegans Hypothetical protein C39B10.3 protein. Length = 188 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +2 Query: 104 DIVVKENPGLCRCCLSEGCYKDLGSEYTWMNENEVYADML 223 +I + + L R C EG + LGS T MNENE Y +L Sbjct: 9 EIQIMQKLTLERRCNYEG--QSLGSNKTDMNENEEYQQLL 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,792,585 Number of Sequences: 27780 Number of extensions: 276880 Number of successful extensions: 714 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -