BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30105 (672 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa... 26 5.7 SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 25 9.9 SPBC19F5.01c |puc1|SPBP8B7.32c|cyclin Puc1|Schizosaccharomyces p... 25 9.9 >SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 25.8 bits (54), Expect = 5.7 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 358 FLKIFICEHIVIVTVLLKKNYFPCRQTSIRPT*W*VVTVAHGHQQC 495 FL I+I E ++ T LLK Y P T+I+ + + A H+QC Sbjct: 691 FLSIYIPECMLPFTKLLKSIYSPDCPTNIQNS--AIKNAASVHEQC 734 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 25.0 bits (52), Expect = 9.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 204 SNITLCTNSAFTDTCESC 257 SN+ LC AFT T E C Sbjct: 1157 SNLRLCLTLAFTMTAEQC 1174 >SPBC19F5.01c |puc1|SPBP8B7.32c|cyclin Puc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 359 Score = 25.0 bits (52), Expect = 9.9 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 220 VQIQLLPIRVSLVESYVSHKL 282 + I LP+ +SL++SYVS ++ Sbjct: 145 LSIDTLPLSISLMDSYVSRRV 165 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,588,088 Number of Sequences: 5004 Number of extensions: 49915 Number of successful extensions: 89 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -