BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30105 (672 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF334585-1|AAK01445.1| 1349|Homo sapiens NIR3 protein. 33 0.93 AB040890-1|BAA95981.2| 1359|Homo sapiens KIAA1457 protein protein. 33 0.93 >AF334585-1|AAK01445.1| 1349|Homo sapiens NIR3 protein. Length = 1349 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 449 PPDGEWLPSPMDISNARGRASRCLPELSTIGCAVF 553 PP GEWL ++N GR S +PE +G V+ Sbjct: 1047 PPSGEWLYLDTLVTNNSGRVSYTIPESHRLGVGVY 1081 >AB040890-1|BAA95981.2| 1359|Homo sapiens KIAA1457 protein protein. Length = 1359 Score = 33.1 bits (72), Expect = 0.93 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 449 PPDGEWLPSPMDISNARGRASRCLPELSTIGCAVF 553 PP GEWL ++N GR S +PE +G V+ Sbjct: 1057 PPSGEWLYLDTLVTNNSGRVSYTIPESHRLGVGVY 1091 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,430,555 Number of Sequences: 237096 Number of extensions: 1888704 Number of successful extensions: 3087 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3087 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -