BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30103 (480 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 3.4 SPAC32A11.04c |tif212|tif22, SPAC6B12.17c|translation initiation... 25 7.8 >SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 25.8 bits (54), Expect = 3.4 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -1 Query: 363 SRRTYVFLAGSLNPNLLCCSSGV*SANLLMPN--VVYGSSRSIGLSLPSVS 217 +RR LA + P++ CS + + L PN ++ SS S PSVS Sbjct: 496 ARRFLYLLAPLMRPSIAQCSDTLLNPIQLYPNSGILSSSSLSTSFGCPSVS 546 >SPAC32A11.04c |tif212|tif22, SPAC6B12.17c|translation initiation factor eIF2 beta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 321 Score = 24.6 bits (51), Expect = 7.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 103 LRDIMTSIKPKNCSKFSSKNITGNTRMMPTES 198 L+D+ +S+K K SK SS + T + TES Sbjct: 76 LKDMFSSMKKKKKSKKSSASAEEQTEDITTES 107 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,875,899 Number of Sequences: 5004 Number of extensions: 35100 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 184020746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -