BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30099 (500 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0269 + 16265191-16265472,16265574-16266149 29 2.1 01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 28 3.7 09_02_0338 + 7426999-7428322,7428390-7428646 28 4.8 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 27 6.4 05_03_0618 - 16262826-16263097,16263111-16263183 27 6.4 01_01_0521 - 3826257-3826616,3826758-3826918,3826992-3827049,382... 27 8.5 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = -3 Query: 237 WEPL---MESTDPQCHILQHRRPRLPL 166 W PL M T P C +L++ RPRLPL Sbjct: 150 WVPLVGEMARTGPLCLLLENPRPRLPL 176 >01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 Length = 80 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 295 CLCSSGCASCRYSRELKPSMGAT 227 C C +GC C+YS E++P+ T Sbjct: 14 CQCGNGCGGCKYS-EVEPTTTTT 35 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.9 bits (59), Expect = 4.8 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -3 Query: 228 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 88 LM C L HR P L + L A L+AI KSYY + Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 6/35 (17%) Frame = +1 Query: 262 SGRKHSRCCTSILRKFSGR------QHCVTVDCCC 348 +G+K RCC S R+ + R + C+ CCC Sbjct: 24 AGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 113 RIARREQKLKEHGASSCISGKRGRRC 190 R+ARR + LK + C G R RRC Sbjct: 11 RMARRRRWLKRRRSGHCRCGLRSRRC 36 >01_01_0521 - 3826257-3826616,3826758-3826918,3826992-3827049, 3827426-3827497,3827582-3827639,3828231-3828347, 3828630-3828782,3829182-3829346,3829814-3830132, 3830276-3830780 Length = 655 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 295 CLCSSGCASCRYSRELKPSMGATNGVNRPPVP 200 C+ GC EL+PS+ A G R P P Sbjct: 71 CMFEDGCTFAHGDEELRPSLTACAGGWRKPSP 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,844,267 Number of Sequences: 37544 Number of extensions: 250995 Number of successful extensions: 571 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -