BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30099 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 1.8 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 7.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 9.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.5 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 9.5 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.5 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 69 RTLNFLNQHSSFY 107 RTLN LN H S Y Sbjct: 412 RTLNSLNNHKSIY 424 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -3 Query: 162 QLEAPCSFNFCSLRAIRRY 106 + + SF C L+A+R Y Sbjct: 131 ECDVALSFKLCMLKAMRNY 149 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 232 LPCSVSAHGNSGRKHSRCCTSILRKFSGRQH 324 L ++ GN +K++ S+ + G QH Sbjct: 196 LVVNIEKSGNESKKYATSSNSLRNRTHGFQH 226 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 232 LPCSVSAHGNSGRKHSRCCTSILRKFSGRQH 324 L ++ GN +K++ S+ + G QH Sbjct: 201 LVVNIEKSGNESKKYATSSNSLRNRTHGFQH 231 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 232 LPCSVSAHGNSGRKHSRCCTSILRKFSGRQH 324 L ++ GN +K++ S+ + G QH Sbjct: 196 LVVNIEKSGNESKKYATSSNSLRNRTHGFQH 226 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 232 LPCSVSAHGNSGRKHSRCCTSILRKFSGRQH 324 L ++ GN +K++ S+ + G QH Sbjct: 196 LVVNIEKSGNESKKYATSSNSLRNRTHGFQH 226 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -2 Query: 397 RERVMFSITSWRGGYHG 347 RE + F T W Y+G Sbjct: 424 REAITFQYTDWEEVYNG 440 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -2 Query: 397 RERVMFSITSWRGGYHG 347 RE + F T W Y+G Sbjct: 424 REAITFQYTDWEEVYNG 440 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,226 Number of Sequences: 438 Number of extensions: 2502 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -