BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30096 (537 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0186 + 1454533-1454710,1455299-1455420,1455508-1455806,145... 29 3.1 04_04_1613 - 34779640-34779747,34780086-34780151,34781155-347812... 27 9.5 >06_01_0186 + 1454533-1454710,1455299-1455420,1455508-1455806, 1455846-1455933,1456015-1456096,1457130-1457242 Length = 293 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 48 ALWRPLAPADFTEHHMPHLLHHTRQPQSSRATPP 149 A WR A AD HH H L + P + PP Sbjct: 4 AYWRYAAAADAARHHHHHQLPLSAAPAAGMPAPP 37 >04_04_1613 - 34779640-34779747,34780086-34780151,34781155-34781214, 34781690-34781795,34781965-34782110,34782934-34783016, 34783157-34783194,34783441-34783472,34783732-34783828, 34783951-34784234,34784752-34784904 Length = 390 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 528 QQGLRVRISCEWCSMRSVSCNRC 460 + + +ISC +C R V+CN C Sbjct: 229 EDDIEEKISCAFCPSRVVACNPC 251 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,600,880 Number of Sequences: 37544 Number of extensions: 105544 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -