BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30093 (501 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 6.2 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 8.2 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.0 bits (42), Expect = 6.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 28 DEQKLMEAVATVGPVSVAIDASHTSFQLYSSG 123 D QKL +A G +DAS SSG Sbjct: 246 DPQKLAIGIAFYGHAFTLVDASQHDLGSPSSG 277 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +3 Query: 306 SXSYPLV*TPPSLPRSCNIHISYVYLW 386 S YP L R C I +S V W Sbjct: 254 SNPYPSEEAKEELARKCGITVSQVSNW 280 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,971 Number of Sequences: 336 Number of extensions: 1423 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -