BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30092 (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 1.3 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 24 1.7 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 6.7 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 1.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 126 YHDAELL*DFLPNC*VLRKLYKERCSHNPG 37 Y E L D + + + R LY++R H+PG Sbjct: 2017 YQRLEFLGDAILDYLITRHLYEDRRQHSPG 2046 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.2 bits (50), Expect = 1.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 39 QGCDYIVLCTTFLVPNN 89 +GCD +++ + VPNN Sbjct: 26 EGCDILIISDPYWVPNN 42 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.2 bits (45), Expect = 6.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 144 YGVTLQGHD*HITSVVIKKNFFVPSIYIHSYCF 242 Y V LQG + I+ + +N +PS H + F Sbjct: 595 YDVVLQGGNSSISLPIFAQNQRMPSEESHEFAF 627 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 344,678 Number of Sequences: 2352 Number of extensions: 6001 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -