BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30092 (384 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC028364-1|AAH28364.1| 1061|Homo sapiens FBXW10 protein protein. 28 8.9 AY729024-1|AAU43731.1| 1052|Homo sapiens ubiquitin ligase specif... 28 8.9 >BC028364-1|AAH28364.1| 1061|Homo sapiens FBXW10 protein protein. Length = 1061 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 139 LLEVLSRCRITLRFPSQLLGTKK-VVQRTM*SQPWKKNV 26 L+E+LS+C I + P + + +K+ V+Q + +P K V Sbjct: 741 LMEILSKCNIQVHSPRESVSSKQTVIQELLPGKPPKSRV 779 >AY729024-1|AAU43731.1| 1052|Homo sapiens ubiquitin ligase specificity factor protein. Length = 1052 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 139 LLEVLSRCRITLRFPSQLLGTKK-VVQRTM*SQPWKKNV 26 L+E+LS+C I + P + + +K+ V+Q + +P K V Sbjct: 712 LMEILSKCNIQVHSPRESVSSKQTVIQELLPGKPPKSRV 750 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,252,229 Number of Sequences: 237096 Number of extensions: 849704 Number of successful extensions: 1173 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1173 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2583773550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -