Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30090
         (620 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    24   1.2  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    23   2.7  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   8.3  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   8.3  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   8.3  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   8.3  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/33 (24%), Positives = 18/33 (54%)
 Frame = +3

Query: 180 GRMAYVVELDEEGTIDSDIPTTLTRVKRTFPKW 278
           G+     + D++  + SD+   L++ K+  P+W
Sbjct: 507 GKATSFFDEDQDRNLASDLAKILSQAKQEIPEW 539


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 453 ESAAPTGGEERPRTGY 500
           +  APT  E+RPRT +
Sbjct: 220 KQGAPTAEEKRPRTAF 235


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -1

Query: 341  RRSASVSRRQDHLH 300
            RRS S S R DH H
Sbjct: 1164 RRSMSASSRGDHHH 1177


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -1

Query: 341  RRSASVSRRQDHLH 300
            RRS S S R DH H
Sbjct: 1164 RRSMSASSRGDHHH 1177


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -1

Query: 341  RRSASVSRRQDHLH 300
            RRS S S R DH H
Sbjct: 1164 RRSMSASSRGDHHH 1177


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 9/14 (64%), Positives = 9/14 (64%)
 Frame = -1

Query: 341  RRSASVSRRQDHLH 300
            RRS S S R DH H
Sbjct: 1164 RRSMSASSRGDHHH 1177


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,311
Number of Sequences: 336
Number of extensions: 2184
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15875032
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)