BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30090 (620 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069471-1|AAL39616.1| 557|Drosophila melanogaster LD21347p pro... 62 4e-10 AE014297-875|AAF54336.1| 557|Drosophila melanogaster CG18005-PA... 62 4e-10 >AY069471-1|AAL39616.1| 557|Drosophila melanogaster LD21347p protein. Length = 557 Score = 62.5 bits (145), Expect = 4e-10 Identities = 28/56 (50%), Positives = 44/56 (78%) Frame = +3 Query: 105 MGKNIFDMILEQKNKKVVRSEMFAPGRMAYVVELDEEGTIDSDIPTTLTRVKRTFP 272 + +NI++++ +++K+V R+E+FAPGRMAYV++LD+E +SDIPTTL R K P Sbjct: 231 LARNIYNLVQARRSKEVPRNELFAPGRMAYVIDLDDE-LGESDIPTTLKRSKFEVP 285 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 257 KADVPEMDERSSASSANDLVVEKLTQIFSYLRHG 358 K +VP E + + ND+V+ KL+QI SYLR G Sbjct: 281 KFEVPVSQEDVATLTTNDIVINKLSQILSYLRAG 314 >AE014297-875|AAF54336.1| 557|Drosophila melanogaster CG18005-PA protein. Length = 557 Score = 62.5 bits (145), Expect = 4e-10 Identities = 28/56 (50%), Positives = 44/56 (78%) Frame = +3 Query: 105 MGKNIFDMILEQKNKKVVRSEMFAPGRMAYVVELDEEGTIDSDIPTTLTRVKRTFP 272 + +NI++++ +++K+V R+E+FAPGRMAYV++LD+E +SDIPTTL R K P Sbjct: 231 LARNIYNLVQARRSKEVPRNELFAPGRMAYVIDLDDE-LGESDIPTTLKRSKFEVP 285 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 257 KADVPEMDERSSASSANDLVVEKLTQIFSYLRHG 358 K +VP E + + ND+V+ KL+QI SYLR G Sbjct: 281 KFEVPVSQEDVATLTTNDIVINKLSQILSYLRAG 314 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,960,792 Number of Sequences: 53049 Number of extensions: 437824 Number of successful extensions: 1319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2559155400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -