BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30084 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_56948| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 31.5 bits (68), Expect = 0.65 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 429 QLSQLCTCTYVDPFRVRSVCVNKDKKELRAGGSRSIVKSRSSHLNIITP*D 581 QLS+L + Y DP +R V K KE+ G + + S S + + TP D Sbjct: 2615 QLSELSSTDYCDPSLIRKVLGVKSSKEISL-GEKDVTTSESVYTSRSTPSD 2664 >SB_56948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 60 YRTMLPARRNRVSHLRC 110 Y+TM+ +RNR+SH+ C Sbjct: 141 YKTMISGQRNRISHIAC 157 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,664,899 Number of Sequences: 59808 Number of extensions: 352214 Number of successful extensions: 793 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -