BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30083 (664 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosa... 29 0.79 SPAC26F1.13c |||leucine-tRNA ligase |Schizosaccharomyces pombe|c... 26 5.6 SPBC1709.06 |dus2||tRNA dihydrouridine synthase Dus2 |Schizosacc... 25 7.4 >SPAC3F10.02c |trk1|sptrk|potassium ion transporter Trk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 841 Score = 28.7 bits (61), Expect = 0.79 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = -2 Query: 72 IKCICTVNTIFFFITHINKFIIF 4 +KC+C++ T++F I +I F+ F Sbjct: 463 LKCVCSMVTLYFIIFNIAAFVTF 485 >SPAC26F1.13c |||leucine-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1111 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +3 Query: 300 LNCYYVLHVAGRFNYLHSSGNYDLSVKSMIRFISSFLGCVDIER 431 +N YY V + N+LH SG + + I C+D +R Sbjct: 232 VNPYYDSFVRWQVNHLHDSGKIKFGERYTVYSIKDGQPCMDHDR 275 >SPBC1709.06 |dus2||tRNA dihydrouridine synthase Dus2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 25.4 bits (53), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 261 SCSCTKHFSVH 293 +C C KHFSVH Sbjct: 113 NCGCPKHFSVH 123 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,472,015 Number of Sequences: 5004 Number of extensions: 48641 Number of successful extensions: 115 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -