BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30082 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 3.0 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 9.2 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 243 TAGWCGNSIPS*MAGIVGLSV-LITARECC 329 T WC IPS GI+G + +I E C Sbjct: 203 TCQWCRKVIPSHQTGILGTTEGMIFCTEAC 232 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -2 Query: 214 SGRAYSTLSVAHLHIELLHRQNQDDNIRK 128 S AYS +++ + ++ LH+ N+D K Sbjct: 597 SSDAYSLIALGNFWLQSLHQPNRDKEKEK 625 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 763,532 Number of Sequences: 2352 Number of extensions: 16298 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -