BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30082 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30890.2 68417.m04387 ubiquitin-specific protease 24, putativ... 29 2.2 At4g30890.1 68417.m04386 ubiquitin-specific protease 24, putativ... 29 2.2 At5g41950.1 68418.m05108 expressed protein 29 3.9 At2g39210.1 68415.m04816 nodulin family protein similar to nodul... 29 3.9 At5g11910.1 68418.m01393 esterase/lipase/thioesterase family pro... 28 5.2 At1g10720.1 68414.m01221 BSD domain-containing protein contains ... 27 9.0 >At4g30890.2 68417.m04387 ubiquitin-specific protease 24, putative (UBP24) identical to ubiquitin-specific protease 24 [Arabidopsis thaliana] GI:11993488 Length = 551 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -2 Query: 340 TSQVQHSRAVIRTDRPTIPAI*DGILLPHQPAVISLS*RRCRSGRAYSTLS--VAHLHIE 167 +S ++++ V+ RP PA+ +G+L P V++ R R A LS + +H E Sbjct: 256 SSSIRNNVTVVEAGRPFRPAMFEGVLRNFTPDVLNNMSGRPRQEDAQEFLSFIMDQMHDE 315 Query: 166 LLHRQNQDDNI 134 LL + Q + Sbjct: 316 LLKLKEQSPKV 326 >At4g30890.1 68417.m04386 ubiquitin-specific protease 24, putative (UBP24) identical to ubiquitin-specific protease 24 [Arabidopsis thaliana] GI:11993488 Length = 551 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -2 Query: 340 TSQVQHSRAVIRTDRPTIPAI*DGILLPHQPAVISLS*RRCRSGRAYSTLS--VAHLHIE 167 +S ++++ V+ RP PA+ +G+L P V++ R R A LS + +H E Sbjct: 256 SSSIRNNVTVVEAGRPFRPAMFEGVLRNFTPDVLNNMSGRPRQEDAQEFLSFIMDQMHDE 315 Query: 166 LLHRQNQDDNI 134 LL + Q + Sbjct: 316 LLKLKEQSPKV 326 >At5g41950.1 68418.m05108 expressed protein Length = 565 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -2 Query: 424 GGLGLGQCYPPGRVLHQTPYHLVTIHDLTSQVQHSRAVIRTDRPTIP 284 GG G G+ PPG + Q+ ++ H L + +R R +P Sbjct: 381 GGSGNGKDMPPGELYSQSAIYIAAAHSLKPSYSVYSSALRLVRSMLP 427 >At2g39210.1 68415.m04816 nodulin family protein similar to nodulin-like protein [Arabidopsis thaliana] GI:3329368, nodule-specific protein Nlj70 [Lotus japonicus] GI:3329366 Length = 601 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 226 VTIMILLPVGAVIVYHLK-WPELLVCLFLSRPVNVVPE 336 V +++LLP+ VI+ K W E V L P+NVV E Sbjct: 254 VIVLLLLPIIVVILEEKKLWKEKQVALNDPAPINVVTE 291 >At5g11910.1 68418.m01393 esterase/lipase/thioesterase family protein low similarity to cinnamoyl ester hydrolase CinI [Butyrivibrio fibrisolvens] GI:1622732; contains Interpro entry IPR000379 Length = 297 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/71 (28%), Positives = 34/71 (47%) Frame = -1 Query: 629 SKSIRCLHSPELSYRHNMSHIGLILQNELFALYLGLRRAVLMYESWLICPCP*CACNRIP 450 S++ R S E + + H ++++N +G+ E+ +IC + NRIP Sbjct: 2 SETRRNQSSDEQIEKSEIQHQRVVIENSHGEKLVGVLHDTGSTETVVICHGFRSSKNRIP 61 Query: 449 MLTNTSLYRRA 417 MLT S + RA Sbjct: 62 MLTIASFFERA 72 >At1g10720.1 68414.m01221 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 429 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 422 RARARTVLPTRSGPSSNALPPRNHSRFNVSGTTFTGRDKNRQTN 291 R A + P G SS++ NH RFN S ++ G +++R ++ Sbjct: 75 RGVANFLAPLPDGSSSSSSDLSNHPRFNQSRSSDPGLNQSRSSD 118 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,368,452 Number of Sequences: 28952 Number of extensions: 324422 Number of successful extensions: 748 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -