BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30080 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 208 4e-56 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.1 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 208 bits (508), Expect = 4e-56 Identities = 103/127 (81%), Positives = 111/127 (87%), Gaps = 1/127 (0%) Frame = +1 Query: 256 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 435 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 436 DVDIRKDLYANTVLSGGTTMYPGIA-TVCKRKSQLSPHRQ*RLRSLLLPERKYSVWIGGS 612 DVDIRKDLYANTVLSGGTTMYPGIA + K + L+P +++ + PE+KYSVWIGGS Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM-KIKIIAPPEKKYSVWIGGS 119 Query: 613 IPRFLST 633 I LST Sbjct: 120 ILASLST 126 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +2 Query: 263 PPLHPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPR 376 PP + + P S LS T ++A+ L PR Sbjct: 678 PPARSPSSQAQASQCPQTASLLSSTHSTLARSLMEGPR 715 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 4 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRP 135 ++ +++HR C P +L +I + P HP + S S P Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/34 (35%), Positives = 12/34 (35%), Gaps = 1/34 (2%) Frame = +1 Query: 91 TP-PRHPASGLSRSRPHRLPHEDPHRARLLVHYH 189 TP P H G S H PH A H H Sbjct: 411 TPGPHHHTMGHGHSHIHATPHHHHSHAATPHHQH 444 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +1 Query: 367 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 477 + +FLG+ + +YN + D + KDL+ +L Sbjct: 328 ETTFLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQIL 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,191 Number of Sequences: 438 Number of extensions: 4812 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -